(data stored in ACNUC7421 zone)

EMBL: CP002299.PE102

CP002299.PE102       Location/Qualifiers
FT   CDS_pept        complement(121885..122877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0102"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: fal:FRAAL6729 putative
FT                   amino acid ABC transporter amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78190"
FT                   /db_xref="GOA:E3J3I8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I8"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADP78190.1"
FT                   /translation="MADTASVYRHSRGQRNPGRAVGIAALLTLALGAAACGGSGGSAKG
FT                   GGGTNGVPRGHLTVADAGFTESKILADIYAQLLTKAGYGVDRTSIASTEIAESSLESGQ
FT                   IDVMPQYVATYADLLSSLVNGKDTPPVSSSDLTASLAALRRFAAGKGLTALNPANAVDQ
FT                   NAFAVTKDFASAHQLRTLSDLGASGVAVTVAATTECPTRPFCQPGLERTYGIKIAGLVQ
FT                   TGFDTAQTKAAVRDGLAQLGLVATTDATVDDYGLVILTDDKKLQNADNLVPIVNTRSLT
FT                   PEISAALNVLAPVLTTADLADLDRRVDSDGEASAAVATEYLTRKRLLPA"
     gtggcagaca cggcatccgt ctaccgtcac tcccgaggcc agcggaatcc cggacgcgcc        60
     gtcgggatcg cggcgctgct gaccctcgcg ctcggcgcgg ccgcgtgcgg cggctcgggc       120
     ggctccgcca agggcggcgg cgggacgaac ggagtcccca ggggccacct gacggtcgcc       180
     gacgcagggt tcaccgaaag caagatcctc gccgacatat acgcccagct gctgaccaag       240
     gccggctacg gcgtggaccg gacgtcgatc gccagcaccg agatcgccga gtcctcgctg       300
     gagagcggcc agatcgacgt gatgccgcag tatgtcgcca cctacgccga cctgctcagc       360
     tccctcgtca acggcaagga caccccgccg gtctcgtcga gcgacctgac cgcctcgctg       420
     gccgcgctgc gccggttcgc cgccggcaaa ggcctgacgg cgctgaaccc ggcgaacgcc       480
     gtcgaccaga acgcgttcgc cgtgaccaag gacttcgcca gcgcccacca gcttcggacg       540
     ctgtccgacc tgggcgccag cggcgtcgcg gtgacggtcg ccgcgaccac ggaatgcccg       600
     acccggccgt tctgccagcc aggtctcgag aggacctacg ggatcaagat cgcgggcctg       660
     gtccagaccg gcttcgacac ggcccagacc aaggcggcgg tccgcgacgg cctggcccag       720
     ctaggtctgg tcgccaccac ggacgcgacg gtcgacgact acggcctggt catcctgacc       780
     gatgacaaga agctccagaa cgccgacaac ctggtgccga tcgtcaacac ccgatccctg       840
     acccccgaga tcagcgcggc gctgaacgtg ctggcccccg tactgaccac ggccgacctg       900
     gccgatctgg accggagggt cgactccgac ggcgaagcgt ccgcggccgt cgccaccgag       960
     tacctgaccc gcaagcgcct cctgcccgcc tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page