(data stored in ACNUC7421 zone)

EMBL: CP002299.PE103

CP002299.PE103       Location/Qualifiers
FT   CDS_pept        complement(123093..124022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0103"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: sma:SAV_2178 ABC
FT                   transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78191"
FT                   /db_xref="GOA:E3J3I9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I9"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADP78191.1"
FT                   /translation="MYRKTTSAFVALALPVVLTLAACGSSGSSGSSASPSAGASAAADA
FT                   GSLTIGSADFTESALLADIYADALAAKGVKITKKLNIGERSVYVKALQDGSIDFIPEYN
FT                   GSILAYLDPKATAKSTAEVTAALPAALGSKLTALTPATAQDSDTITVTKATADKYHLTS
FT                   IADLTSVADKLTFGAPAAFQTRPDGIPALKSVYGVTFGNFTALSASGTVTVTSLKNGTI
FT                   DGADIFSTDPSFASEGFVALADPKNMFAAQNVTPVVATAKVTPTIKDTVNAVSAKLTTA
FT                   ILADLDAKVGTGDPDAVAKQWLTSVGLA"
     atgtaccgca agaccacgtc ggcctttgtc gccctcgcac tgcccgtcgt gctgacgctg        60
     gccgcctgcg gctcgagcgg cagcagtggt tcatccgcca gcccctcggc cggcgccagc       120
     gcggccgccg acgcgggctc gctgacgatc ggttcagccg acttcaccga gagcgccctg       180
     ctcgccgaca tctacgccga cgcgctggcg gccaagggcg tgaagatcac caagaagctg       240
     aacatcggtg agcggtccgt ctacgtcaag gcgctgcagg acggctcgat cgacttcatc       300
     cccgagtaca acggctcgat cctggcctac ctggacccga aggcgacggc gaagagcacc       360
     gcggaggtga ccgccgcgct gcccgccgcc ctgggcagca agctgaccgc gctgaccccg       420
     gccacggccc aggactccga cacgatcacg gtgaccaagg cgaccgccga caagtaccac       480
     ctgacctcga tcgcggacct gacctcggtc gccgacaagc tcaccttcgg cgccccggcc       540
     gcgttccaga cccggcctga cggcatcccg gcgctcaaga gcgtctacgg ggtcaccttc       600
     gggaacttca ccgcgctctc ggccagtggc accgtcacgg tgacctcgct gaagaacggg       660
     acgatcgacg gcgcggacat cttctcgacc gacccgtcgt tcgcgtccga gggcttcgtc       720
     gccctggccg acccgaagaa catgttcgcc gcgcagaacg tgactccggt cgtggcgacc       780
     gccaaggtca cgccgaccat caaggacacc gtcaacgccg tgtccgcgaa gctgaccacg       840
     gcgatcctcg cggacctcga cgcgaaggtc gggaccggcg acccggacgc ggtcgccaag       900
     cagtggctga ccagcgtcgg tctcgcctga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page