(data stored in ACNUC7421 zone)

EMBL: CP002299.PE104

CP002299.PE104       Location/Qualifiers
FT   CDS_pept        complement(124032..124871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0104"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rop:ROP_23160 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78192"
FT                   /db_xref="GOA:E3J3J0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78192.1"
FT                   /translation="MSAATTLASSNLPSLGLVPGWLTTASHWWGPHGLLVSLREHVLYT
FT                   VVAVVVAMIIAVPIGLLVGHTGRGGFAIAGLANAIRAVPAFGLLILLYVVVSPKIHYHG
FT                   SISWLVPRGAFGSLIPVEAMLVVLAIPPILTNTYAGVQGVDPDVRDAARGMGMRGWQVV
FT                   TRVELPIALPLVLAGVRSAVLQVIATATIAGYLPFLGGLGYQIFINGLPQINDPDVGYP
FT                   AMIGAALLVAVLAVVADLLLLGLQRLVVSRGIAGRYRTTLPAPVPPASAAPPASAEI"
     gtgagcgcgg cgaccacgct ggccagtagc aacctgccca gtctcgggct ggtgcccggc        60
     tggctgacga cggcgtcgca ctggtggggg ccgcacggtc tgctggtctc cctgcgcgag       120
     cacgtgcttt acacggtggt cgcggtcgtc gtcgcgatga tcatcgccgt tccgatcggg       180
     ctgctggtcg gccacaccgg gcgcggtggc ttcgccatcg ccgggttggc gaacgcgatt       240
     cgcgcagtgc ccgccttcgg gctgctgatc ctgctctacg tggtggtgag cccgaagatc       300
     cactatcacg gctcgatcag ctggctggtg ccgcgcggcg cgttcggctc cctgatcccg       360
     gtcgaggcca tgctcgtcgt gctggccatc ccccccatcc tcacgaacac ctatgccggc       420
     gtgcagggcg tggacccgga cgtacgggac gccgcacgcg gaatgggcat gcgcgggtgg       480
     caggttgtca cgagggtgga gctgcccatc gcgctgccgc tggtgctggc cggcgtccgc       540
     agcgcggtgc tccaggtgat cgcgaccgcg accatcgccg gctacctgcc cttcctcggc       600
     ggcctcggct accagatctt catcaacggc ctgccccaga tcaacgaccc ggacgtcggc       660
     tacccggcga tgatcggcgc ggccctgctc gtcgcggtgc tggccgtcgt cgccgacctg       720
     ttgctgctcg gcctgcagcg gctcgtcgtc tcgcgcggca tcgccggccg ctaccgcacc       780
     accctgccag cccccgtacc cccggcatcc gcagcacccc cggcatccgc cgaaatctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page