(data stored in ACNUC7421 zone)

EMBL: CP002299.PE106

CP002299.PE106       Location/Qualifiers
FT   CDS_pept        complement(125518..126669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0106"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nml:Namu_1406 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78194"
FT                   /db_xref="GOA:E3J3J2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78194.1"
FT                   /translation="MIRFESVTKRYPDGTVAVDALDLVAETGKITVLVGPSGCGKTTSL
FT                   RMINRMIEPTSGRIWLDDRDTATIRSDQLRRGIGYVIQHAGLFPHRTVLDNITTVPRLL
FT                   GRGRREARGQALELLERVGLPAAFAGRYPAQLSGGQQQRVGVARALAADPPVMLMDEPF
FT                   SAVDPVVRGQLQDEFLRLQHELRKTIVLVTHDIDEAIRLGDQVAVLRVGGRLAQLAPPG
FT                   ELLASPADSFVAGFVGRDRGYRALGFTHAGELPLLDEPTVTVGAPLKSAPDLARDGWVL
FT                   ALDEERRPLGWLATSATAEVGAATATGEGTVDADKLNLGGTLTPEAGTLREALDAALSS
FT                   PSGRGVVVHADGTFAGTVTASDVLVRIEQERAAPPGSPEQPAP"
     gtgatccgtt tcgagtcggt gaccaagcgg tacccggacg gcaccgtcgc ggtggacgcc        60
     ctggaccttg tcgccgagac cggcaaaatc accgtactcg tcggcccttc cggctgcggc       120
     aagacgacca gcctgcggat gatcaacagg atgatcgagc cgacctcggg ccggatctgg       180
     ctcgacgacc gggacaccgc gacgatcagg tccgaccagc tccgccgcgg catcggctac       240
     gtgatccagc acgccgggct gttcccgcat cggaccgtcc tcgacaacat caccaccgtt       300
     ccccgcctgc tcggccgcgg ccgccgcgag gcgcgcggcc aggccctgga gctgctcgaa       360
     cgggtgggcc tgccagcggc gttcgcgggc cggtacccgg cccagctgtc cggcggccag       420
     cagcagcgcg tcggcgtcgc ccgagcgctc gcggccgacc cgccggtcat gctgatggac       480
     gagccgttct cggccgtcga cccggtggtc cgcggccagc tacaggacga gttcctccgc       540
     ctgcagcacg agctgcgcaa gacgatcgtg ctggtcaccc acgacatcga cgaggcgatc       600
     cggctcggcg accaggtggc cgtgctgcgc gtcggcggcc ggctcgcgca gctggccccg       660
     ccgggcgaac tgctggccag cccggccgac tcgttcgtcg cgggcttcgt cggccgcgac       720
     cgtggctacc gggccctcgg gttcacccac gcaggcgagc tgccgctgct ggacgagcca       780
     acggtgacgg tcggcgcccc gctcaagtcg gcgcccgacc tggccaggga cggctgggtt       840
     ctggcactcg acgaggagcg gcgcccgctg ggctggctcg ccacttctgc gacagcggag       900
     gtcggcgcag ccaccgcgac gggcgagggc acggtcgacg cggacaagct gaacctcggc       960
     ggcacgctca cccccgaggc gggaacgctg cgcgaggcgc tcgacgcggc cctttcgtcg      1020
     ccgagcgggc ggggggtcgt cgtccacgcc gacggcacct tcgccggtac tgtcaccgcg      1080
     tccgacgtgc tggtccggat cgagcaggag cgcgccgccc cgcccggctc acccgaacag      1140
     ccggcgccat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page