(data stored in ACNUC7421 zone)

EMBL: CP002299.PE11

CP002299.PE11        Location/Qualifiers
FT   CDS_pept        15961..16578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78099"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J261"
FT                   /inference="similar to AA sequence:KEGG:FRAAL0022"
FT                   /protein_id="ADP78099.1"
FT                   /translation="MDETLRRAALAAKGFMPDDEGDALYAAAAEVPAGGLILEVGTYCG
FT                   KSTLYLAAAARAAGARVVTVDHHRGSEENQAGWEHHDPTVVDPHTGRMDTLPFLRRNLW
FT                   DAGVEDVVTVVVGRTEEVGGWWTTPVALLFIDGGHAEEQAQADYAAWARHVAPGGALLI
FT                   HDVFPDPADGGQAPYHLYLRALAEGFKERSRTGSLRVLERVE"
     gtggatgaga cgttgcgccg tgctgcgctg gccgccaagg gcttcatgcc cgacgacgag        60
     ggtgacgcgc tctacgccgc cgcggctgag gtgccggccg gcggcctgat cctcgaggtc       120
     ggcacctact gcggcaagtc gacgctgtac ctggccgcgg ccgcgcgggc ggcgggcgcg       180
     cgggtcgtga ccgtcgatca ccaccgtggc tccgaggaga accaggccgg ctgggagcac       240
     cacgacccga ccgtcgtcga cccgcacacc ggccggatgg acacgctgcc cttcctgcgc       300
     cgcaacctct gggacgccgg tgtcgaggac gtcgtcaccg tggtcgtcgg gcgcaccgag       360
     gaggtcggcg gctggtggac gaccccggtc gcgctgctgt tcatcgacgg tggccatgcc       420
     gaggagcagg cccaggccga ctacgcggca tgggcccggc acgtcgcccc cggcggtgcg       480
     ctgctcatcc acgacgtctt ccccgacccc gccgacggtg gccaggcgcc gtaccacctc       540
     tacctgcgcg ccctggccga gggcttcaag gagcggtccc gcacgggttc gctgcgggtt       600
     ctcgaacgcg tcgagtag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page