(data stored in ACNUC7421 zone)

EMBL: CP002299.PE111

CP002299.PE111       Location/Qualifiers
FT   CDS_pept        complement(135866..136780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0111"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: gob:Gobs_1560
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78199"
FT                   /db_xref="GOA:E3J3J7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J7"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADP78199.1"
FT                   /translation="MDTDQLRALLTDVAAGRVDTDTALARLAAGPLGDGAGFVDLGYAR
FT                   VDTHRGVRTGDPEVVFAAGKTAAETVGIVAALRAASTGDGRPTLVTRANRETVDALVAR
FT                   WPDADVTGRWSPDPAADPRPAGDAGRLATVAVGALPPARGRVVVVCAGTSDAPVADEAA
FT                   LTVAASGAGVEVLRDVGVAGLHRLLAVRDVLAAADCLVVVAGMEGALPSVIGGLVGVPL
FT                   VAVPTSVGYGAAFGGLAALLGMLTACAPGIAVCNIDNGFGAGLFAARVARAAAGASPES
FT                   ASAAATSPGAGLRAAAAGSAGYR"
     gtggacaccg accagttgcg cgcgctgttg accgacgtcg ccgccggcag agtggacacg        60
     gacacggcgc tggcccgcct cgccgccggc ccgctcggcg acggcgcggg cttcgtcgac       120
     ctcggctacg cgcgggtcga cacccatcgc ggcgtgcgga cgggtgatcc cgaggtcgtc       180
     ttcgccgcgg gcaagacggc ggccgagacg gtcggcatcg tggccgcgct gcgggccgcg       240
     agcaccggcg acggccgccc caccctggtc acccgggcga accgcgagac ggtcgacgcg       300
     ctggtcgccc gctggccgga cgcggacgtc accggccgct ggtcacccga cccggcggcg       360
     gacccgcggc cggctggcga cgcggggcgg ctcgcgaccg tcgccgtcgg tgccctgcca       420
     cccgcccgcg gccgagtcgt cgtcgtctgc gccggcacct cggacgcgcc cgtcgccgac       480
     gaggcggcgc tgaccgtcgc ggccagcggc gcgggggtcg aggtgctgcg cgacgtcggc       540
     gtcgccgggc tgcaccggct gctggccgtc cgcgacgtgc tcgccgccgc agactgtctg       600
     gtggtcgtcg ccgggatgga gggggcgctg cccagcgtca tcggcggtct ggtcggcgtg       660
     ccgctggtcg cggtcccgac cagcgttggg tacggggccg cgttcggcgg gctcgccgcg       720
     ctgctcggca tgctgaccgc ctgcgcgccc ggcatcgcgg tctgcaacat cgacaacggt       780
     ttcggcgccg gcctcttcgc cgcgcgggtg gcccgtgccg ccgccggtgc cagccccgag       840
     agcgcctcgg ccgcggccac ctctcccgga gccgggctgc gcgcggcggc ggccggctcg       900
     gccgggtacc ggtga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page