(data stored in ACNUC7421 zone)

EMBL: CP002299.PE113

CP002299.PE113       Location/Qualifiers
FT   CDS_pept        complement(137861..139621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3J9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6714"
FT                   /protein_id="ADP78201.1"
FT                   /translation="MPPATGGLPQEPSDDSDDAGHTPADDTTAERPAADGRGIVIPPAR
FT                   RSPDDYPADYPRLTGRHERAHAARGPGDRAPGDRAASGQATGAHPVPIRPASPLLATAA
FT                   LFTTPPAATRPAGRASVDRVVDLPAKPRPLDTGRPVRAAEAAFAAGGTGALIGVGQPVG
FT                   KETTAKTTPSPPAASCGADDSGTGTSDRRQFHRIAGAVIGALLIEGQILEVSGMLAASP
FT                   VQLALDRAEHILTQALGAHEIIPPAHILAQTARLHRGLERLARRRMPDSQWRRLRLLAG
FT                   RVAVLRADAAFKQGNVTAARVLTAQGYAAGLAAGDGPLCGSAREVGAVTEFYDGRPDEA
FT                   LRLARDGQRHVGSGPVRARLVCQEARALAALGDVQGAAKALDQAYDLADQISPDRWGRP
FT                   GPSFDEFNPVEVAYNATTALCLLGRPRTAEQHAELALPKLDAMDAPGFRSVIRLDLSLA
FT                   LARAGRLELERVCHLASEAIQISWGRTVSSVSSRADQLLEATRVHGEVPEVRDLAALVR
FT                   EWQRSAAQQSPAAGLATTQLSTGQLAGAAIVAAGGVTLAKAAGRTTKAATKMITSGDTE
FT                   PGLTHPEASD"
     atgccgccag ccacgggtgg actgccccag gagccatcgg acgactccga cgacgccggg        60
     cacacgccgg ccgacgacac caccgccgag agaccggccg ccgacggtcg cgggattgtc       120
     atcccgcccg ccaggcgatc cccggacgac taccccgccg actacccgcg cctgacaggc       180
     cgccacgagc gcgcccacgc cgcccgcgga cctggcgacc gcgcacccgg cgaccgcgcc       240
     gcgagcggtc aggcgacggg agcccacccc gtgcccattc gtccggccag cccactcctt       300
     gccaccgccg ccctgttcac cacgccgccg gcggccaccc ggccggccgg ccgggcatcg       360
     gtcgaccgtg tcgtggacct cccggccaag ccccgtccgc tcgacaccgg gcggcccgtt       420
     cgggcggcgg aggccgcgtt cgccgccggc gggaccggcg ccctgatcgg cgtgggccag       480
     ccggtcggca aggagaccac agccaagacc acgccgagcc cgcccgccgc gtcctgcggc       540
     gcggacgatt caggtactgg gacgtcagac cgccgccagt tccaccggat cgccggggcg       600
     gtcatcggcg ctctgctcat cgagggacag atcctggagg tgtccggcat gctcgcggcg       660
     agccccgtac aactggcgct cgaccgggca gagcacatcc tgacccaggc gctcggcgcc       720
     cacgagatca ttccgccggc ccacatcctc gcccagaccg cccggctgca ccgaggcctc       780
     gagcggctgg cgcgccgccg gatgcccgac agccagtggc gccggctgcg gctgctcgcc       840
     ggccgggtcg ccgtgctgcg ggccgacgcg gccttcaagc agggcaacgt cacggccgcc       900
     cgggtgctca ccgcgcaggg gtacgccgcg gggctcgcgg ccggcgacgg cccgctgtgc       960
     ggctcggctc gcgaggtcgg cgccgtcacg gagttctacg acggccgccc ggacgaggcg      1020
     ctgcggctgg cccgggacgg ccagcgccac gtcggctccg ggccggtacg ggccaggctg      1080
     gtctgccagg aggcccgggc gctcgccgcc ctgggcgacg tgcagggcgc cgcgaaggcg      1140
     ctcgaccagg cctacgacct cgccgaccag atctcgccgg accgctgggg ccggccagga      1200
     cccagcttcg acgagttcaa cccggtggag gtggcctaca acgcgaccac cgcgctgtgc      1260
     ctgctcggcc ggccccggac cgccgagcag cacgccgagc tcgcgctgcc gaagctcgac      1320
     gcgatggacg cccccggctt ccgctcggtg atcaggctgg acctgtcgct ggcgctcgcc      1380
     agggccggcc gcctcgagct ggaacgggtc tgccacctgg ccagcgaggc gatccagatc      1440
     tcctggggcc gcacggtgtc ctcggtgtcc tcgcgggccg accagctact ggaggcgacc      1500
     cgggtacacg gtgaggtgcc cgaggtccgg gatctggccg cgctggtccg cgagtggcag      1560
     cgctcggctg cccagcagag cccggccgcc ggcctggcga ccacacagct gtcgaccggg      1620
     cagctcgcgg gcgcggcgat cgtcgcggcg ggcggcgtca ccctcgccaa ggccgccggc      1680
     cgcaccacca aggccgccac caaaatgatc accagcggtg acaccgaacc gggcctgacc      1740
     cacccggaag cgagcgactg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page