(data stored in ACNUC7421 zone)

EMBL: CP002299.PE114

CP002299.PE114       Location/Qualifiers
FT   CDS_pept        140268..141185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0114"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6711 GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78202"
FT                   /db_xref="GOA:E3J3K0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78202.1"
FT                   /translation="MSWRGEPGTDPLVGPRRFTDQAVDPAVARISGFTDRTALTRELEE
FT                   LAFRGWSALRTERVDGWVLRDSEGATRRGNSVWPHDDVADLPEALARVDRFYGRAGRPA
FT                   FVQLTPASRPSGLRQALDVAGYEPEQGPTDVCVAGLAGIVAGVAGLAERAAPPAGRARG
FT                   PVRVALAETPDDGWLDVCAAGGMSMFGQHRAASVAVLRRIETPAIYVTATVDGVPVGAG
FT                   RGVADGDWLGIYSMATLPAARGQGAATTVMAALSTWATSVGARRALLQVEEQSTAARRI
FT                   YAALGFLPVYRYTYRRRATGPAAP"
     atgtcgtggc gcggcgaacc agggaccgat ccgctggtcg gcccgcgccg gttcaccgac        60
     caggccgtcg acccggcggt cgccaggatc agcgggttca ccgaccggac cgcgctgaca       120
     cgcgagctgg aggagctggc gttccgcggg tggtcggcgc tgcggaccga gcgggtcgac       180
     ggctgggtgc tgcgcgactc cgagggtgcc acccggcgcg gcaactcggt ctggccgcac       240
     gacgacgtcg ccgacctgcc ggaagccctc gccagggtcg accggttcta cggccgggcc       300
     gggcggcccg cgttcgtcca gctgaccccc gcgtcccgtc ccagcgggct gcggcaggcg       360
     ctcgacgtgg ccggctacga gcccgagcag ggcccgaccg acgtctgcgt cgcgggcctc       420
     gccgggatcg tcgccggcgt cgcgggtctc gccgagcggg cggcgccccc ggccggccgt       480
     gcgcggggcc cggtccgggt cgcgctcgcc gagaccccgg acgacggctg gctggacgtc       540
     tgcgccgccg gcggtatgtc gatgttcggc cagcaccggg cggcgagcgt cgcggtcctg       600
     cgccggatcg agacccccgc gatctacgtc acggcgacgg tcgacggcgt gccagtcggc       660
     gcgggccggg gcgtcgccga cggcgactgg ctcgggatct acagcatggc gacgctgccc       720
     gcggcccgcg gccagggcgc cgcgaccacg gtcatggcgg cgctgtccac ctgggcgacc       780
     agcgtcggcg cccggcgtgc cctcctgcag gtagaggagc agagcaccgc ggcccgacgg       840
     atctacgccg ccctgggctt cctgccggtc taccgctaca cctaccgccg cagggcgacc       900
     ggcccggccg cgccatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page