(data stored in ACNUC7421 zone)

EMBL: CP002299.PE118

CP002299.PE118       Location/Qualifiers
FT   CDS_pept        143188..143622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0118"
FT                   /product="Protein of unknown function DUF3180"
FT                   /note="PFAM: Protein of unknown function DUF3180; KEGG:
FT                   fal:FRAAL6707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78206"
FT                   /db_xref="GOA:E3J3K4"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K4"
FT                   /inference="protein motif:PFAM:PF11377"
FT                   /protein_id="ADP78206.1"
FT                   /translation="MRPTRARELAAAVLVAGVLAYLLLVWTYRTLPQLPRTGPLSVFVI
FT                   AVLELQTASITRRRLAGRPGTKPIMPITVARLAVLAKASSLTAAVMAGGWAALLAYTTA
FT                   HLNTYGTAGADLITAGLGLGSAVALAVAALLLERVCRVRR"
     atgagaccga cccgggcccg cgagctggcc gccgccgtcc tggtcgccgg ggtgctggcg        60
     tacctgctgc tcgtctggac ataccggaca ctgccgcagc tgccgcgcac cgggccgctg       120
     tcggtgttcg tgatcgcggt gctggagctg cagacggcga gcatcacccg ccgccggctg       180
     gccggccggc cgggaaccaa accgatcatg ccgatcacgg tggcccggct ggccgtgctg       240
     gccaaggcca gctcgctcac cgcggcggtg atggccggcg gctgggccgc cctgctcgcc       300
     tacaccaccg cccatctgaa cacctatggc accgcgggcg ccgacctcat cacggccggc       360
     ctcggcctcg gctcggccgt cgccctggcc gtcgcggcgc tgctgctcga acgggtctgc       420
     cgggtgcggc gctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page