(data stored in ACNUC7421 zone)

EMBL: CP002299.PE120

CP002299.PE120       Location/Qualifiers
FT   CDS_pept        complement(147685..148392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0120"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: saq:Sare_2570 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78208"
FT                   /db_xref="GOA:E3J3K6"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3K6"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADP78208.1"
FT                   /translation="MTRPYVVLSCATSIDGYIDDASETRLRLSNEADFDRVDEVRAGCD
FT                   AILVGAGTIRADDPKLLIRSPARRRARMSRGLPSHPLKVTLTATGDLDPSARFFTAGDP
FT                   DGTDGAGQVVYTATDAAARARARLGAVATVVEAGDPIDLPTVLADLATRGVARLLVEGG
FT                   GAVHTQFLTEDLADELHLVVAPFFVGDPRAPRFVGPGTFPHDPTHPARLAETTQLGDVV
FT                   LLRYALSPRYPGA"
     gtgacccggc cctacgttgt gctcagctgc gccacctcga tcgacggcta catcgacgac        60
     gcgagcgaga cccggctgcg actctcgaat gaggcggatt tcgaccgggt agacgaggtg       120
     cgcgctggat gcgacgcgat cctggtcggc gccgggacga tccgggctga cgacccgaag       180
     ctcctgatcc ggtcgcctgc ccggcggcgg gcgcggatga gccgcggact cccctcgcac       240
     ccgctgaagg tgacgctcac cgccacggga gacctcgacc cctccgcacg gttcttcacc       300
     gctggcgatc ccgatgggac ggacggggcc ggccaggtcg tctacacggc caccgacgcc       360
     gccgcgcgag cccgcgcccg tctcggcgcg gtcgccacgg tcgtcgaagc gggagacccc       420
     atcgatctgc ccaccgtgct ggccgacctt gcgacccggg gcgtggcccg cctcctggtc       480
     gagggcggag gtgccgtgca cacccagttc ctgaccgagg acctggccga cgagctgcac       540
     ctcgtggtcg ccccgttctt cgtcggcgac ccccgtgccc cccgcttcgt cggccctggc       600
     acgttcccgc acgatccgac ccaccccgcc cgcctggccg aaaccaccca gctcggcgac       660
     gtcgtcctgc tccgctacgc cctctcgccc cgctacccag gcgcctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page