(data stored in ACNUC7421 zone)

EMBL: CP002299.PE125

CP002299.PE125       Location/Qualifiers
FT   CDS_pept        complement(153237..154211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0125"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   fal:FRAAL5881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78213"
FT                   /db_xref="GOA:E3J4P4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADP78213.1"
FT                   /translation="MAVVTKVLVVLAWVAAAGLAVAVLGRLTHLDDVLWPYVLVNALTP
FT                   VLFLPAYPAFAVGVATHRYALAAVALVAVVAHLVWLWPEVRPGSASAAPAGSAQFRLLT
FT                   TNLEMDNGRAGTLGRQIRADSPDVVVVEELSNVTYYGLMKSGALAGYHYSASRPQFGAF
FT                   GAGVWSRYPLSDVAAPLVGGLDSLRVTVTLPTGQRFRLFAVHTLSPQSSSNVRVWRTQL
FT                   ADLRREVRATTLPVVLAGDFNATRDMRPFRNVLAAGVTDAHDDVHAGWAPTWNAHFPIL
FT                   PPVWRLDHVLISPQFTATGLRVGKSYGSDHLPLVADLALRPSS"
     atggcggtcg tgacgaaggt gctggtcgtc ctcgcctggg tggcggcggc cgggctcgct        60
     gtcgccgtgc tgggcaggct gacccatctg gacgacgtgc tctggcccta cgtcctggtg       120
     aacgcgctca ccccggtcct gttcctgccc gcgtatcccg ccttcgcggt cggcgtcgcc       180
     acgcatcgtt acgcgctggc cgcggtggcc ctcgtcgcgg tggtcgccca tctcgtctgg       240
     ctgtggccgg aggtccggcc gggcagcgcg agcgccgcgc cggccggttc ggcccagttc       300
     cggctgctca ccacgaacct ggagatggac aacggccggg ccggcacgct cggccggcag       360
     atccgggccg actccccgga cgtggttgtc gtcgaagagc tgtcgaacgt gacctactac       420
     ggcctgatga agtcgggggc actcgccggc taccactaca gtgcctcccg gccgcagttc       480
     ggggcgttcg gcgcgggtgt ctggtcccgc tatccgttgt cggacgtcgc ggcgccgctc       540
     gtcggtgggc tggactcgct gcgcgtgacg gtcactctgc cgacggggca gcgcttccgg       600
     ctgttcgccg tgcacacgct ctcaccgcag agctcgagca acgttcgcgt gtggcggacg       660
     cagctggccg acctgcgccg ggaggtgcgg gccacgacac tgccggtcgt cctggccggt       720
     gacttcaacg ccacccggga catgcgcccg ttccgcaacg tcctcgccgc gggggtgacc       780
     gacgcgcacg acgacgtgca cgccggctgg gcgccgacct ggaacgccca cttcccgatc       840
     ctgccgccgg tgtggcggct cgaccacgtg ctcatctcac cccagttcac cgcgaccggg       900
     cttcgggtgg gcaagagcta cggcagcgat cacctgccac tggtggccga tctcgcgctg       960
     cggccctcgt cgtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page