(data stored in ACNUC7421 zone)

EMBL: CP002299.PE128

CP002299.PE128       Location/Qualifiers
FT   CDS_pept        157757..159103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gob:Gobs_0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78216"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P7"
FT                   /inference="similar to AA sequence:KEGG:Gobs_0438"
FT                   /protein_id="ADP78216.1"
FT                   /translation="MAKSRLIGRPGEARGIPISGRDLICLHMRTVAYLGPIEAPSPEQV
FT                   RGALRRLAELLPAHRILRRVDRAAPRWVTVPAAELPGHCDAMVIDMTDTTAASATSVPA
FT                   TAATAATPETIVARLYNWPVTDLPFQIAVGADFCALLVDHACIDGLSINEIWPELIRCA
FT                   VTGEYPVSIAKPSIRFPLIRALDNYYRRKPKRLVETVRVPHPTPPADATEPGPLVPWHQ
FT                   EFGVVSVRFGKDVLAEIRSWRLANAKGITRTMVLFAAARAALETSDLPPVRPGVNISVD
FT                   MRKFLPQGAVLYGNFAPSIYVCPADGCDPAQLNAVIDEVMSVARPLATMALVASTAKRR
FT                   FKRTAQPPTLAEATARPALSLIHCGRLKAFEKLPWTGSPADRRYVIGSTPGDPDGISVF
FT                   ISEIHGGVDVTATFNVSTFDPAVVRGALEILATEPTRALDARRQVPSAR"
     atggcgaaaa gcagattgat cggccggccc ggcgaggcgc ggggtattcc gatttccggc        60
     cgcgacctga tctgtctgca catgcggacc gtcgcctatc tcggcccgat tgaggcgccg       120
     tcgccggaac aggttcgcgg cgcgttgcgg cggctggccg agctccttcc ggcgcatcgg       180
     atactccgcc gggtcgaccg ggcggcgccg cgctgggtga ccgttccggc cgccgagctg       240
     cccggacact gcgacgccat ggtcatcgac atgaccgaca cgacagccgc gtccgccacg       300
     tctgtgcccg cgacggccgc cacggccgcg acgccggaga cgatcgtcgc gcggctctac       360
     aactggccgg tcacggacct tccctttcag atcgcggtcg gcgcggattt ctgcgcgctg       420
     ttggtcgacc acgcgtgtat tgacggcctg agcatcaacg agatctggcc cgaactcatc       480
     cggtgcgccg tcaccggtga gtatcccgtc tcgatcgcga agccgtcgat tcgattcccg       540
     ctgattcggg cgctggacaa ctactaccgc aggaagccga agcgactggt cgagacggtg       600
     cgcgtcccgc accccacccc gcccgccgac gcgacggagc cgggcccgct ggtgccgtgg       660
     caccaggagt tcggcgtggt cagcgtccgg ttcggcaagg acgtcctcgc cgagatccgc       720
     tcctggcggc tggcgaacgc caagggcatc accaggacga tggtcctgtt cgccgcggct       780
     cgggccgcgc tggagacgtc tgacctgccg ccggtgcgcc cgggcgtcaa catcagcgtc       840
     gacatgcgca agttcctgcc ccagggcgct gtgctgtatg gcaacttcgc gccctcgatc       900
     tacgtctgcc cggccgacgg ctgcgacccg gcccagctga acgcggtcat cgacgaggtc       960
     atgtcggtcg ctcggccgct ggccacgatg gcgctggtcg cctcgaccgc gaagcggcgc      1020
     ttcaagcgca cggcccagcc gccgacgctc gccgaggcca ccgcgcgacc ggcgctgtcg      1080
     ctcatccact gcggccggct gaaggcattc gagaagctgc cgtggacggg cagcccggcc      1140
     gaccgtcgct acgtgatcgg cagcaccccg ggagacccgg acggaatctc ggtcttcatt      1200
     tcggaaatcc acggcggtgt cgacgtcacg gcgaccttca acgtctccac cttcgacccg      1260
     gcggtcgtcc gcggagcgct ggaaatcctc gcgaccgagc cgacgcgcgc cctggacgcc      1320
     cgacgtcagg tcccgagcgc gcgctga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page