(data stored in ACNUC7421 zone)

EMBL: CP002299.PE130

CP002299.PE130       Location/Qualifiers
FT   CDS_pept        complement(163300..164640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0130"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG: glycoside
FT                   hydrolase family 16"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78218"
FT                   /db_xref="GOA:E3J4P9"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4P9"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADP78218.1"
FT                   /translation="MFTSVGVLAVVALGVGIGLSRAGNLSASPMPAYASLVGDFTCITS
FT                   TDGSCAVAPGLNATPDQLTVEAWAQDGGSDTKVPVVATNVGAYGFVLRANGPDGAPVER
FT                   RRIHGSYVAWFHCASNAGPPCKHQRGGGHTAGGTATALPTEQSTDPATTPDDSTTSPVP
FT                   GPTSTVLPSSVPTSPAGIPQPGQSTPAVVHTAPTVTTAPATTAPAPANGAALQWADEFD
FT                   GAAGTGVNKADWTAVSGSHHGELECYTPKSSNVAMDGKGDLVLTARREAGCDGMPYTSG
FT                   RLEGVNKRTFKYGYFEVRARMPTTTGAFPAFWTLGANYPSVGWPRSGEIDIVEITANLP
FT                   SSVHTNIHGVDASGKSWQSGWGGVGTFASSSNVGDSFHTYGLNWTSTALQFYFDGKLIH
FT                   TINKSSVPVWLWDQENYLLLNLAITSSSGPDVQTMDVDYVRVYSTKP"
     atgttcactt cggtcggcgt tctggctgtc gtcgcgttgg gggtgggcat cgggctgagc        60
     cgggccggca acctctcggc aagtcccatg cccgcctacg cgtcgcttgt gggtgacttc       120
     acctgcatca cctcgaccga cgggtcgtgc gccgttgccc ccggcctgaa tgcgacgcca       180
     gatcagctca ccgtcgaagc ctgggcccag gacggcggat ccgacaccaa ggtacccgtc       240
     gtcgcgacga acgtaggggc ctacggattc gtcctgcgcg ccaacggacc ggacggcgca       300
     ccggtcgagc gacgcagaat ccacggctcg tacgtggcct ggttccactg cgcctccaac       360
     gcggggccgc cgtgcaagca ccagcgcggc gggggccaca cggccggggg aacggcgacc       420
     gcgctgccca ccgaacagtc gaccgacccg gcgacgacgc cggacgactc cacgacctca       480
     ccggtgcccg ggccgaccag caccgtgctg cccagttcgg ttccgacctc cccggctggc       540
     atcccgcagc ctggccagtc cactccggcc gtggtccaca ccgccccgac agtcacgacc       600
     gcgccggcca ccaccgctcc ggcgcccgcg aacggcgcgg cgctccagtg ggcggacgag       660
     ttcgacgggg ccgccggcac cggagtgaac aaggccgact ggacggcggt cagcggctcg       720
     catcatggcg aactggagtg ctacaccccg aagagcagca acgtggcgat ggacggcaag       780
     ggtgatctcg tcctcaccgc ccggcgtgag gccggctgcg acgggatgcc ttacacctcc       840
     ggtcgacttg aaggcgtgaa caagcgcacc ttcaagtacg gatatttcga ggtacgggcc       900
     cggatgccta cgaccaccgg tgcgttcccg gccttctgga cacttggcgc gaactatccg       960
     tccgtcggct ggccgcgcag tggtgaaatc gacatcgtcg agatcaccgc caacctgccg      1020
     tcctccgtgc acaccaacat ccacggcgtg gacgcgtccg ggaagtcctg gcagtccggg      1080
     tggggcgggg tcgggacgtt cgcctcgtcg agcaacgtgg gcgactcctt ccacacctac      1140
     ggtctgaact ggacgagcac cgcgctccag ttctacttcg acggcaagct gatccacacg      1200
     atcaacaaga gctccgtacc ggtctggctc tgggaccagg agaactacct gctgctcaac      1260
     ctggccatca cgagcagcag cggcccggac gtccagacca tggacgtcga ctacgtccgg      1320
     gtctactcga ccaagccgta g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page