(data stored in ACNUC7421 zone)

EMBL: CP002299.PE131

CP002299.PE131       Location/Qualifiers
FT   CDS_pept        165487..166776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0131"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; Di-glucose
FT                   binding within endoplasmic reticulum; KEGG: aau:AAur_0779
FT                   putative beta-1,3-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78219"
FT                   /db_xref="GOA:E3J4Q0"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR021720"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q0"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADP78219.1"
FT                   /translation="MRVAALAVLVLTVAGPLAGCGLTHSGSSTARPSGPAERWVAGSVG
FT                   ITDSRGTTWQPDVSVAQGGQVTTPGSAVAGTGNPALYRKARVGGQGYELPVARPGTYAV
FT                   VLHVLAPQDVRAGQNVFDITVDGRTVISAIDVAARVGAGHALAVLVPVTETGDSIDLGL
FT                   RVRHGEARVSAVSVAFESTAAARTTFADDFTGPAGATVDSRWTFETGGGGWGNNELGVY
FT                   TSSTRNVSLDGKGNLAITARRENIRDTDGKTYQYTSGRLTTKRSFDLRYGHVETRLKLP
FT                   TGGGLLPAFWAVGSNVDNVGWPVSGEIDMLELPAPDGSIYASIHGPTQSDAAYAHVAGI
FT                   YPLPPESVAGFHTFAMDWYPGVFQFSVDGMVYGSVSEDDMPSGQTWVFDHPYYLIFNLA
FT                   VGGNWPGSPPAGTPFPQQMVVDYVRVTGHN"
     atgcgggtcg ccgcgctggc cgtgctggtc cttacggtgg ccgggccgct ggctggctgc        60
     ggcctcacgc attccggatc ctcgacggcc aggccgagtg gcccggccga aaggtgggtc       120
     gcaggctccg tcgggattac cgacagccgg ggcaccacgt ggcagccgga tgtctccgtc       180
     gcccagggcg gccaggtcac cacgcccggt tccgccgtag ccggaacggg taatccggcc       240
     ctgtaccgca aggcgcgggt gggcggtcag ggctatgaac ttccggtggc caggccgggc       300
     acctacgccg tagtccttca cgtattggcg ccacaggacg tccgtgctgg gcagaatgtg       360
     tttgatatca ccgttgatgg ccgaacggtg atatcagcga tcgacgtcgc cgcgcgggtc       420
     ggcgccggcc acgcgttggc cgtgctcgtg cccgtgacgg agacgggcga cagcatcgac       480
     ctgggcctgc gcgtgcgcca cggcgaggcc agagtgagcg ccgtcagcgt ggccttcgag       540
     agcaccgcgg cggcccgcac caccttcgcg gacgacttca ccggcccggc cggcgccacg       600
     gtggactcca ggtggacgtt cgagaccggg ggtggcggct ggggcaacaa tgagctcggg       660
     gtttacacgt ccagcactcg gaacgtgtca ctcgacggta agggaaacct ggcgatcacg       720
     gccaggcgtg aaaatattcg cgacacggac gggaaaacct accagtacac ctctgggcgg       780
     ctgaccacca agagatcgtt cgacctccgg tacggtcatg tcgagaccag gttgaagctg       840
     ccgaccggcg gcgggctgct tcccgcgttc tgggcggtgg gtagcaacgt cgataacgtc       900
     ggatggcccg tcagtggcga gatagacatg cttgaactgc cggcgccgga cggatccatt       960
     tacgcctcga tccacggtcc gacgcagtcc gacgccgcct atgcgcacgt ggccggaatt      1020
     tatccgctgc cacccgagtc ggtggccggc tttcacacgt tcgcaatgga ctggtacccg      1080
     ggagtctttc agttctccgt cgacggaatg gtctacggtt cggtaagcga ggacgacatg      1140
     ccgtcgggcc agacatgggt gttcgaccat ccctattacc tgatcttcaa cttggcggtc      1200
     ggcgggaact ggccggggtc gccgcccgcc ggcaccccgt ttccgcagca gatggtcgtc      1260
     gactacgtcc gtgtcacagg tcacaactag                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page