(data stored in ACNUC7421 zone)

EMBL: CP002299.PE133

CP002299.PE133       Location/Qualifiers
FT   CDS_pept        170144..171541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0133"
FT                   /product="membrane protein involved in the export of
FT                   O-antigen and teichoic acid-like protein"
FT                   /note="KEGG: membrane protein involved in the export of
FT                   O-antigen and teichoic acid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78221"
FT                   /db_xref="GOA:E3J4Q2"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q2"
FT                   /inference="similar to AA sequence:KEGG:Trad_0522"
FT                   /protein_id="ADP78221.1"
FT                   /translation="MTSVTDEAAAVAGAEQPRRKMSMLYRNGLAGVANSVLSALLGAGF
FT                   WVIAARESSTAAVGVGTALVSALMALATLSQMSLGGALSAYLPGAGEHQRALVLRSYGM
FT                   AVLISVVLGGAFAVAAPRFDHSFHVLAPVGAAIGFTLSVTVWAIFSLQDLVVTSLRKAI
FT                   WLPLENTTYSLTKFVVLVAMGSGTTALMLLSAWVVPAAIATVVVSSIVFGKLLNKRDPG
FT                   AEPAALTEAPQLEGYRRFLAGTTLALIFEQLAVTLLPVFIVAGLGTEKGAEFGIAWMLI
FT                   QALDQFPMILGFSMTVEGAQPGADVRPIHRTLRKRTLAGMGGLVVVGILAAPIITTIFG
FT                   GAYRHGSTTVLQLLLIGSLGRAVNSLALCAALARRRLAPLIGIHGAIAVMVPIGALILG
FT                   RWWGLVGVGIAWSVAQSVVALGVLVAERREERSERVDTPPGLRRPAAIEANIETTMRLT
FT                   PIQRRSR"
     atgaccagcg tcacggacga ggcggcggcc gtcgccgggg ccgagcagcc ccggcgcaag        60
     atgagcatgc tttaccgcaa cggcctggcc ggcgtcgcca acagcgtgtt gtcggcgctg       120
     ctgggcgctg gtttctgggt catcgcggcc cgcgagtcca gcacggcggc ggtcggcgtc       180
     ggaacggccc tcgtctcggc gctgatggcg ctcgcgacgc tgagccagat gagcctgggc       240
     ggagccctct ccgcctacct gcccggtgcg ggcgagcacc agcgggctct ggtccttcgg       300
     tcctacggca tggccgtgct catcagcgtg gtgctcggtg gcgccttcgc cgtggcggcg       360
     ccgcgtttcg accactcgtt ccacgtgctg gcgccggtcg gcgcggcgat cggcttcacc       420
     ctctcggtca cggtctgggc gatcttctcg ttgcaggacc tggtggtcac ctcgctgcgc       480
     aaggcgatct ggctgcctct ggagaacacc acctacagcc tcaccaagtt cgtggtgctg       540
     gtagccatgg gctccggcac gacggcgttg atgctgctgt ccgcctgggt cgtgccggcc       600
     gccatcgcca cggtcgtcgt ctcctcgatc gtgttcggca agctgctgaa caagcgggac       660
     ccgggcgccg agccggccgc cctgaccgag gcgccgcagc tggagggcta ccggcgcttc       720
     ctggccggca cgacgctggc gctcatcttc gagcagctgg cggtgaccct gctgccggtg       780
     ttcatcgtcg ccggcctcgg caccgagaaa ggcgccgagt tcggcatcgc ctggatgctc       840
     atccaggcgc tcgaccagtt cccgatgatt ctcgggttct cgatgacggt cgagggcgcg       900
     cagcccggcg ccgacgtgcg gccgatccac cggaccctgc gcaagcgcac cctggccggc       960
     atgggaggcc tggtcgtcgt cgggatcctg gcggcgccca tcatcaccac gatcttcggc      1020
     ggcgcctacc ggcacggctc gacgaccgtg ctccagctcc tcctgatcgg ctccctcggc      1080
     cgggccgtga acagccttgc gctgtgcgcc gcgctggccc ggcgccggct ggctcccctg      1140
     atcgggattc acggcgccat cgcggtgatg gtcccgatcg gcgccctgat cctcgggcgc      1200
     tggtggggcc tggtcggcgt cggcatcgcc tggtcggtgg cgcagagcgt cgtcgctctc      1260
     ggcgtactcg tcgccgaacg ccgcgaggag cggtccgagc gggtcgacac gccgcccgga      1320
     ctacgacgcc cggcggcgat cgaggcgaac atcgagacca ccatgcgcct cacgccgatc      1380
     cagcgacgat cccggtag                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page