(data stored in ACNUC7421 zone)

EMBL: CP002299.PE138

CP002299.PE138       Location/Qualifiers
FT   CDS_pept        178341..179162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0138"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; KEGG: fal:FRAAL6699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78226"
FT                   /db_xref="GOA:E3J4Q7"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q7"
FT                   /inference="protein motif:PFAM:PF08282"
FT                   /protein_id="ADP78226.1"
FT                   /translation="MSIRAVYTDLDGTMVGPKGSFFVAEDGSHTLEAAQALVDLHAAGL
FT                   TLVLVSGRTRPQLVEAAAIFGADGFIGELGAIVGWDHGRSSEILRGAMPESYTQVPEEL
FT                   LHELIAANPGRLELHTPWHTGRELDVMLRGKVDVATADAWLRDAGFDWLSMRDNGLIAP
FT                   HLMPGLGVNPHVYHLVPEGVGKGEAVAWDLRRRGIDPADAIAIGDSASDLTMARFVGRM
FT                   HLVANALRHPDIPTLLTSYDNVVVEKEAVTLGWASAIRAAVAGRAPLAATS"
     gtgagcatcc gtgccgtcta caccgatctc gacggaacca tggtcggccc gaaaggctcg        60
     ttcttcgtcg ccgaggacgg atcccacacc ctcgaggcgg cgcaggcgct cgtcgacctg       120
     catgccgccg gcctgacgct cgtgctggtc agcggccgga ccagaccgca gctcgtcgag       180
     gcggcggcga tcttcggggc cgacggcttc atcggcgagc tcggcgcgat cgtcggctgg       240
     gaccacggcc gcagcagcga gatcctgcgc ggcgcgatgc cggagagcta cacccaggtg       300
     cccgaggagc tgctgcacga gctgatcgcg gccaaccccg gccggctcga actgcacacc       360
     ccgtggcaca cgggccgcga gctggacgtg atgctgcgtg gcaaggtcga cgtggcgacc       420
     gccgacgcct ggctgcgcga cgccggcttc gactggctct cgatgcgtga caacgggctg       480
     atcgctccgc acctcatgcc gggcctgggc gtgaacccgc acgtctacca cctggtgccc       540
     gaaggggtgg gcaagggcga ggccgtcgcc tgggacctca ggcggcgcgg catcgacccg       600
     gcggacgcga tcgcgatcgg cgactcggcg agcgacctga cgatggcccg tttcgtcggc       660
     cggatgcacc tggtcgccaa cgccctgcgg cacccggaca tccccaccct gctcacctcc       720
     tacgacaacg tcgtggtcga gaaggaggcg gtcaccctcg gctgggccag cgccatccgc       780
     gctgccgtgg ccggtcgggc tccgctggcg gccacgtcct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page