(data stored in ACNUC7421 zone)

EMBL: CP002299.PE139

CP002299.PE139       Location/Qualifiers
FT   CDS_pept        179326..181017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0139"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: fal:FRAAL6698 trehalose-phosphate synthase;
FT                   PFAM: glycosyl transferase family 20"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78227"
FT                   /db_xref="GOA:E3J4Q8"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4Q8"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ADP78227.1"
FT                   /translation="MLAGPDPAAAGTARVLVASNRGPVAFSLSDSGALLARRGSGGLVS
FT                   GMQEVIRDAAAAAAGQGDAAEGGETDPEDPPSGIVWVCAALSDADRRAVRVAPDGRLDR
FT                   AGFDTGGAAIRMLDVDRVVFDRAYNGVANRTLWFVLHLLFAPASEPSFGAAFWRDWEAY
FT                   EAYNAMFADALALDAAHGAAVLIQDYHLTLVPGLLRKLRPDLRISHFTHTPWAPPDYFR
FT                   ILPDRVSRAVIGGMLGADRLGFLTARWATAFRDCARVLLGDEVEIDGVETCVLDGGLDL
FT                   APAPGPMAPPAALIGGPALGQVFDERPPPVVDPGQPGHRVRIGVHPLGVDAPALRARAA
FT                   AKDVAARAAELREEVGDRRLIVRVDRTELSKNIVRGLDAYRELLRNHPDWCGRVMHLVC
FT                   AYPSRHDLPEYREYTAAVQRIATEIEDEFATDGWLPLRLEVTDDYPRSLAALTLADVLV
FT                   VNPIRDGMNLIAKEGPTVSDRDVALILSREAGAYAELGADALVVNPYDVTETAEAMDAA
FT                   LRMPPAERRRRADRIAALAARLPPGDWFREQLAALPAPPAEVVLRG"
     gtgctggcgg ggcccgatcc ggcggccgcc ggcaccgcac gggtgctggt cgcctcgaac        60
     cgaggcccgg tcgcgttctc cctttccgat tccggcgcgc tgctggcccg gcggggcagc       120
     ggcggcctgg tgagcgggat gcaggaggtg atccgggacg cggcggcggc cgcggccggg       180
     cagggcgacg ccgccgaggg cggtgagacc gaccccgaag atccgccgtc cggcatcgtc       240
     tgggtgtgcg cggcgctgtc ggacgcggac cggcgggcgg tgcgggtggc accggacggc       300
     cggctcgatc gggccggttt cgacaccggc ggcgccgcga tccggatgct cgacgtggac       360
     cgggtcgtct tcgaccgggc ctacaacggg gtcgccaacc gcacgctgtg gttcgtgctg       420
     cacctgctgt tcgccccggc cagcgagccg agcttcgggg ccgcgttctg gcgcgactgg       480
     gaggcctacg aggcctacaa cgcgatgttc gccgacgcgc tggccctcga cgcggcccac       540
     ggcgcggccg tcctgatcca ggactatcac ctgacgctgg tcccgggcct gctgcgcaag       600
     ctgcgccccg acctgcggat ctcgcacttc acccacaccc cgtgggcgcc gccggactac       660
     ttccggatcc tgccggaccg ggtgtcccgg gccgtgatcg gcggcatgct cggggccgac       720
     cggctcggct tcctcaccgc ccgctgggcg accgcgttcc gggactgcgc ccgcgtcctg       780
     ctcggcgacg aggtcgagat cgacggtgtc gagacctgcg tgctggacgg cggtctcgat       840
     ctcgcgcccg ccccggggcc gatggccccg ccggcagcgc tgatcggcgg gccggcgctc       900
     ggccaggtct ttgacgagcg gcctccgccc gttgtcgacc cgggccagcc cggtcaccgg       960
     gtccggatcg gcgtccaccc gctcggggtc gacgccccgg cgctgcgggc gcgggccgcg      1020
     gcgaaggacg tggcggcgcg cgccgccgag ctgcgcgagg aggtcggcga ccggcgtctg      1080
     atcgtccgcg tcgaccgcac cgagctgtcg aagaacatcg ttcgtggcct ggacgcctac      1140
     cgggagctgt tgcgcaacca tccggactgg tgcggccggg tcatgcacct ggtctgcgcc      1200
     tacccgtccc ggcacgacct gcccgagtac cgggagtaca ccgccgcggt gcagcggatc      1260
     gccaccgaga tcgaggacga gttcgccacc gacggctggc tgccgctgcg cctggaggtc      1320
     acggacgact acccgcgctc gctggccgcg ctgacgctgg ccgacgtgct ggtggtcaac      1380
     ccgatccgcg acgggatgaa cctgatcgcc aaggagggcc cgacggtctc cgaccgggac      1440
     gtggccctga tcctgtcccg ggaggccggg gcctacgccg agctgggcgc ggacgcgctg      1500
     gtcgtcaacc cgtacgacgt cacggagacc gccgaggcga tggacgcggc cctgcggatg      1560
     ccgccagccg agcgccgccg gcgcgccgac cggatcgccg cgctggccgc ccggctgcca      1620
     cccggcgact ggtttcgcga gcagctcgcc gcgctgcccg cccctccggc cgaggtcgtg      1680
     ctgcgcggct ga                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page