(data stored in ACNUC7421 zone)

EMBL: CP002299.PE141

CP002299.PE141       Location/Qualifiers
FT   CDS_pept        complement(182377..183009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78229"
FT                   /db_xref="GOA:E3J4R0"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6696"
FT                   /protein_id="ADP78229.1"
FT                   /translation="MSGPGSTTTAARSAAAPPPRRPTGNSRLRALGAALIAVLAVGVGI
FT                   LLVNLLHNPKSGAQPPTASRASTAAPVTSATPRATASAHPTSATSSARPSASSPRPTTQ
FT                   PPAGSGAVAPVVILNDSKIEGLADAASGPVKDAGFTVDRVGGYISTYNVPVTTVFYEDD
FT                   LKAAAQNLQQRVSGIVKIEPIAGTDIKLYEPGKLILVVTRDFPTPAP"
     atgagcgggc ccggctccac caccaccgcg gcccgctccg ccgccgcgcc gccgccgcgc        60
     cgcccgaccg gcaacagccg gctgcgggcc ttgggcgccg cgctgatcgc cgtgcttgcc       120
     gtgggcgtcg gcattctgct ggtcaacctg ctgcacaacc cgaagtcggg ggcacagcca       180
     cccaccgcga gccgcgcctc gaccgccgct ccggtcacgt ccgcgacgcc ccgggccacg       240
     gcgagcgccc acccgaccag cgcgacgtcg tcggcccggc ccagcgcgtc ctcgccacgc       300
     ccgaccaccc agccgccggc cggctcgggc gccgtggccc cggtcgtgat cctcaacgac       360
     tccaagatcg agggtctcgc cgacgccgcc agcggcccgg tcaaggacgc gggcttcacg       420
     gtcgaccggg tcgggggcta catcagcacc tacaacgtgc cggtcaccac cgtcttctac       480
     gaggacgacc tcaaggccgc ggcccagaac ctccagcagc gggtctccgg catcgtcaag       540
     atcgagccga tcgccggcac cgacatcaag ctctacgaac cgggcaagct gatcctcgtc       600
     gtcacccgcg acttccccac tccggccccg tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page