(data stored in ACNUC7421 zone)

EMBL: CP002299.PE142

CP002299.PE142       Location/Qualifiers
FT   CDS_pept        complement(183006..183392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78230"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6695"
FT                   /protein_id="ADP78230.1"
FT                   /translation="MDDAQQQESTAPQAAQPAEASPPAGAGGLSDRDARVLRFERRTWR
FT                   YPAAKDEAIRTEFGLSPARYYQLLNALIESPAALAAEPVLVGRLSRLRAARRQGWSPAA
FT                   SVTAGSGRAPSGADVVEPYPTDPT"
     gtggacgacg cgcagcagca ggagtcgacg gccccccagg cggcccagcc tgctgaagcg        60
     tccccgccgg ctggcgctgg agggctgtcg gaccgagatg cccgggtgct gcggttcgag       120
     cggcggacct ggcgctaccc ggcggccaag gacgaggcca tccgcacgga gttcggcctc       180
     tccccggcgc gctactacca gttgctgaac gcgctgatcg agtccccggc cgcgctggcc       240
     gccgaacccg tgttggtcgg tcggctctcg cggctgcggg ccgcgcgccg ccagggctgg       300
     tccccggcgg cgagcgtcac cgcgggctcg ggccgcgctc cgtccggtgc cgacgtcgtc       360
     gagccctacc cgacggaccc gacatga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page