(data stored in ACNUC7421 zone)

EMBL: CP002299.PE143

CP002299.PE143       Location/Qualifiers
FT   CDS_pept        complement(183682..184968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78231"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL3800"
FT                   /protein_id="ADP78231.1"
FT                   /translation="MPALRPSRVSAAAARSRRMVLVAAAAALATAATACGATTKPGGSG
FT                   SACDSPGFTSNTVKIGYLYPDTGPFAQALLATRSGFIARVEQQNAAGGVHGRKIITATG
FT                   DDQGDNGTNLQAARQLVDVGQVFGIVEGTVAASGGADFLRQRDVPVVGLPAESIWADHR
FT                   YPNMFAHAYVYAGADAGSVDTFGQFVKAQGGTKVAVIGTDVSAASNQLDGEIVDSLRAV
FT                   GVEISTQTFIYNAVHTDPIALGRQLMAAGVDTAVGSLSAQDFSHIMMGAKTAGANIRIY
FT                   LSASGYDHSVLAQDGRQLAGLYTWLNYLPFEANTPADQAFFKAMSDYAPELQPPDQELA
FT                   LIEYILTDMFITGLERAPACPTRADFISTMRNLTGYTADGLLPGAVDFKNWGRLSLCYT
FT                   FVRVNDAGNGYDIVKDPAGKPEWCGNAIR"
     gtgcccgcac tgcgcccgtc gcgagtttcc gccgctgctg cccggtcgcg tcgcatggtt        60
     ttggtcgccg cggccgccgc cctggcgacc gccgcgacgg cctgcggcgc gacgacaaaa       120
     cccggaggca gcggcagcgc ctgcgactcg cctggattta cctcgaacac cgtcaagatc       180
     ggctacttat atccggacac cgggccgttc gctcaggcgc tgctcgccac gcggtccgga       240
     ttcatcgcca gagtcgagca gcagaacgcc gccggcgggg tgcacggccg taagatcatc       300
     accgcgaccg gtgatgatca gggcgacaac ggcacgaacc tgcaggccgc ccgccagctc       360
     gtcgacgtcg gccaggtctt cggcatcgtg gagggaaccg tcgcggcctc cggcggcgcc       420
     gacttcctgc gccaacgcga cgtgcccgtg gtcggcctgc cggccgagag catctgggcc       480
     gaccaccggt acccgaacat gttcgcccac gcctacgtct acgccggcgc cgacgccggc       540
     tccgtggaca cgttcggcca gttcgtgaag gcccagggcg gcacgaaggt cgcggtcatc       600
     ggcaccgacg tctcggcggc ctccaaccag ctcgacgggg agatcgtgga cagcctgcgg       660
     gccgtcggcg tcgagatctc cacccagacg ttcatctaca acgcggtaca caccgacccg       720
     atcgcgctcg gccgccagct gatggcggcc ggcgtggaca cggccgtcgg ttcgctgtcc       780
     gcccaggact tcagccacat catgatgggc gcgaagacag ccggcgcgaa catcaggatc       840
     tatctgtcgg ccagcgggta cgaccacagc gttctcgccc aggacggccg ccagctcgcc       900
     ggcctttata cctggttgaa ctatctgccg ttcgaggcga acactccggc ggaccaggcg       960
     tttttcaagg cgatgagcga ctacgcgccc gagctccagc cgccggacca ggagctcgcg      1020
     ctcatcgagt acatcctcac cgacatgttc atcacgggcc tcgaacgggc gccggcctgc      1080
     ccgacccgcg ccgacttcat ctcgacgatg cggaacctga ccggctacac cgctgacggc      1140
     ctgctgcccg gcgcggtcga cttcaagaac tggggccggc tgagcctgtg ctacacgttc      1200
     gtccgggtca acgacgcggg caacggctac gacattgtca aagacccggc cggcaagccg      1260
     gagtggtgcg gcaacgccat tcggtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page