(data stored in ACNUC7421 zone)

EMBL: CP002299.PE150

CP002299.PE150       Location/Qualifiers
FT   CDS_pept        195041..196039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0150"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gob:Gobs_0441 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78238"
FT                   /db_xref="GOA:E3J4R9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4R9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78238.1"
FT                   /translation="MSTVSVVVCSHLVARFTLLVAALESLRAQTRAPDQVVVVVDGDDE
FT                   LLKKLHDRGGDELVLSTGGRTGLSNARNTGLRAVTTDFVAFLDDDATAEPAWLEALMAA
FT                   VSSSANVLGVGGRTLPAWESKQPAWFPDELLWTVGCSHLGLPASCQPVRNVFGGCALFR
FT                   RPLFDEVGGFDDRLGRKAKGAAGCEETEFCIRAQRLHAGGTFLYEPAAVIHHRVPLGRS
FT                   SPRYVLRRCWEEGRSKALLRVITRGVGQPERAARRKSSLGPERDFLLRVLPSGVFGGLR
FT                   AAVRGQPAAAGRALLLLVGSATTVVSFVGAALLSTRRGGATVPEPAGLAQP"
     gtgagcacgg taagtgtcgt cgtctgtagt catctggtgg cgcggttcac gctgttggtg        60
     gcggcgctgg agtcgttgcg cgcacagacc cgggcgcccg accaggtcgt cgtggtcgtc       120
     gacggcgatg acgagctgtt gaagaagctg cacgaccgtg gtggcgacga gctggttctg       180
     tcgaccggcg gccggacggg cctgtccaat gcccgcaata ccggtctgcg ggccgtgacg       240
     acggacttcg tcgcgttcct ggacgatgac gcgaccgcgg agcctgcctg gcttgaggcg       300
     ctgatggcgg ccgtgtcgag ttccgcgaat gtgctcgggg tcggcggccg aacgctgccc       360
     gcgtgggaga gtaaacagcc ggcctggttt ccggacgagc tgttgtggac ggtcgggtgc       420
     agtcatctgg ggctgccggc gtcgtgccag ccggtccgaa acgtgttcgg cgggtgtgcc       480
     ctgttccggc ggccgctttt cgacgaggtc ggtggcttcg acgaccggct gggccgcaag       540
     gcgaagggcg ccgcggggtg cgaggagacc gagttctgta tccgggcgca gcgcctgcac       600
     gctggtggca ccttcctgta cgagccagcc gccgtcatcc atcaccgggt gccgctcggg       660
     cgcagctcgc cccgctacgt gctgcgccgc tgctgggagg aagggcggtc gaaggcgctc       720
     ctcagggtga tcactcgtgg ggtggggcag ccggagcgcg cggcgcgccg gaagtcgtcg       780
     ttgggtcccg aacgggactt tctgctgcgg gttctgccct ccggcgtgtt cggcgggctt       840
     cgggcggcgg tgcgcggcca gcccgccgcg gccggccggg ccctgctgct gctcgtgggt       900
     tccgcgacga ccgtggtcag cttcgtgggg gcggcgctcc tgtccacccg tcgtggcgga       960
     gcgaccgtgc cggagccggc tgggctggcc cagccgtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page