(data stored in ACNUC7421 zone)

EMBL: CP002299.PE151

CP002299.PE151       Location/Qualifiers
FT   CDS_pept        196104..196877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0151"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   fal:FRAAL1353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78239"
FT                   /db_xref="GOA:E3J4S0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S0"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP78239.1"
FT                   /translation="MYHSVGQGASSAFRRWQVDPGLFAEQLGALVDAGYRLVGLSAALD
FT                   EPDERTVAVTFDDGFVDFLGATELLVAAGCGATLYVPTAHVARRARWMAGYREAELRIM
FT                   DWSELSEVAAAGIEVGSHGHAHAELDLMPAHLMRADILLSRRMLADRLGRPVRSFCYPF
FT                   GYHTRTVRSAVASAGFASACEVGYGLHPRAGDAFAVRRLIVTGDTRPADMRRLVTEGQD
FT                   SPVMQLRRRTRTPWRIYRAAHHIATRSHAEAEPGD"
     atgtaccaca gtgtcgggca gggggcgagc agcgcgtttc gccgctggca ggtcgacccg        60
     gggctgttcg ccgagcagct gggcgcgctg gtggacgcgg gctaccggct ggtcgggctg       120
     tccgcggcgt tggacgaacc ggacgagcgc acggtcgccg tcacgttcga tgacgggttc       180
     gtcgacttcc tcggcgcgac ggagctgctg gtcgccgccg gctgcggcgc cacgttgtat       240
     gtgccgaccg cgcatgtcgc gcggcgtgcc cggtggatgg cgggctatcg cgaggccgag       300
     ctgcggatca tggactggtc ggaactctcc gaggtcgcgg cggccgggat cgaggtgggg       360
     tcgcacgggc acgcacacgc ggagctggac ctcatgcccg cgcatctcat gcgcgcggac       420
     atcctgttga gccgccgcat gctggccgac cggctgggcc gcccggtgcg tagtttctgc       480
     tacccgttcg gctaccacac ccggaccgtc cgctcggcgg tcgcttcggc gggcttcgcg       540
     tcagcctgcg aggtcggcta cggcctgcat ccccgagcgg gcgacgcgtt cgcggtgcgc       600
     cggctcatcg tcaccggcga cacccggccc gccgacatgc gccgactcgt caccgaaggc       660
     caggacagcc cggtgatgca gctacgccgc cggacccgga ccccgtggcg gatctaccgc       720
     gccgcccacc acatcgccac ccggagccat gccgaggccg aaccgggcga ctga             774
//

If you have problems or comments...

PBIL Back to PBIL home page