(data stored in ACNUC7421 zone)

EMBL: CP002299.PE154

CP002299.PE154       Location/Qualifiers
FT   CDS_pept        201793..203259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0154"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: lysyl-tRNA synthetase; TIGRFAM: lysyl-tRNA
FT                   synthetase; PFAM: tRNA synthetase class II (D K and N);
FT                   nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78242"
FT                   /db_xref="GOA:E3J4S3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S3"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADP78242.1"
FT                   /translation="MTADEPTVDGAARLPRSGYQTDLTSADVQAAPDGTPARVAGRLML
FT                   WRRMGGLVFGTIQDRAGRVQISLNRNELGEETYKEWHSSVKVGDFVGVTGVVFTTRKGE
FT                   RTVGATDFAVLNKAVRALPDKWHGIADVETRYRRRYLDLLANPASRERFQTRSRVISRI
FT                   RRFLDDADFLEVETPVLTEAASGAAARPFITRHNALGEDFYLRISPETYLKRVVAGSFD
FT                   RVYEIGRNFRNEGIDPSHLQEFTMLEWYAAYWDYRDNMRFVRELILAILDDVIGSRTVT
FT                   YEGTKLDFGADWPVIDYRDAVESRTGVDLRVVRDFETLKTKCADLGLDVSKAASYAALV
FT                   DLLYKKTVRPELVQPCFLVGHPVELVPLARRSDDDPTRLDMFQVVANGWELVKAYSELV
FT                   DPVDQRERLEEQADLRAAGDDETMMLEEDFIEAMEYGMPPMSGLGLGIDRFIALITDAP
FT                   TLRDVVLFPSMRGAKGPESTEPAQAAGPES"
     atgacagccg acgagccgac ggtcgacggg gcggcacggc tgcccaggtc cgggtaccag        60
     acggacctga cgtcggcgga cgtccaggcg gcgccggacg ggacgccggc ccgcgtcgcc       120
     gggcgtctca tgctctggcg ccggatgggt ggccttgtct tcgggaccat ccaggaccgc       180
     gccggccggg tgcagatctc gctgaaccgc aacgaactgg gcgaggagac ctacaaggag       240
     tggcacagct cggtgaaggt cggcgacttc gtcggcgtca ccggcgtcgt cttcaccacc       300
     cgcaagggcg agcggaccgt cggcgccacc gacttcgcgg tgctcaacaa ggccgtgcgc       360
     gcgctgccgg acaagtggca cggcatcgcc gacgtcgaga cccgctaccg gcgccgctac       420
     ctggacctgc tggcgaaccc cgcgtcccgg gagcggttcc agaccaggtc ccgggtgatc       480
     agccgaatcc ggcgcttcct cgacgacgcc gacttcctcg aggtcgagac gcccgtcctc       540
     accgaggcgg cctccggcgc cgcggcgcgc ccgttcatca cccggcacaa cgcgctgggc       600
     gaggacttct acctgcgcat ctcgccggag acctacctca agcgggtcgt cgccggctcg       660
     ttcgaccgcg tctacgagat cggccggaac ttccgcaacg agggcatcga tccctcgcat       720
     ctgcaggagt tcacgatgct ggagtggtac gcggcgtact gggactaccg cgacaacatg       780
     cgcttcgtcc gtgagctgat cctggcgatc ctcgacgacg tgatcggttc ccggacggtc       840
     acctacgaag gaaccaagct cgacttcggc gcggactggc cggtcatcga ctaccgggat       900
     gcggtcgaaa gtcgtaccgg ggtcgatttg cgggtcgtgc gcgacttcga gacgttgaag       960
     acgaagtgcg ccgacctcgg tctggatgtc agcaaggcgg cctcctacgc ggcgctcgtc      1020
     gacctgctct acaagaagac ggtccggccc gagctggtcc agccttgctt cctggtcggg      1080
     catccggtgg agctggtgcc gctggcgcgg cgcagcgacg acgacccgac ccggctcgac      1140
     atgttccagg tcgtcgcgaa cggctgggag ctcgtcaagg cgtactcgga gctggtcgac      1200
     ccggtcgacc agcgcgagcg gctggaggag caggccgacc tgcgcgcggc cggcgacgac      1260
     gagacgatga tgctcgaaga ggacttcatc gaggcgatgg agtacggcat gccccccatg      1320
     tccggcctgg ggctcggtat cgaccggttc atcgcgctga ttacggatgc tccgacattg      1380
     cgcgatgtcg tcctcttccc gtccatgcgc ggcgcgaagg gcccagagtc gacggagccg      1440
     gcgcaggccg ccggaccgga aagctga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page