(data stored in ACNUC7421 zone)

EMBL: CP002299.PE155

CP002299.PE155       Location/Qualifiers
FT   CDS_pept        203447..204652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0155"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78243"
FT                   /db_xref="GOA:E3J4S4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78243.1"
FT                   /translation="MPGDIGYYLVYLPLGTIGLVRWLCWLARRIPAALYRPVGGDLRLP
FT                   LTVVVPVYQEDPEVFTRALTSWLANDVDEVILVIDATDTACRRIAADFPVTVLVTEVPG
FT                   KRDALRRGWEAASTELVALVDSDTIWADDVAAEVCKPFADPAVGGVATRQNVYNPRGFL
FT                   QRITDLFLDCRYFDENAAQSVMGRALSCLSGRTAIYRRALLVEVSHEFMTEKFLGVQCM
FT                   SGDDKRLTTLLLERGHATVLQRSARVWSSFPDTWRLFCRQRLRWARNTWRSDLRALSRR
FT                   WVWRRPFLAFSMVEKAVSGFTLLVSPTFMTLALLRHHWFFCGCLACWWWLSRAAKALPH
FT                   LRRQPSSFFLIPGWILVSFAMSVIKIGALVTVRRQRWLTRQVAVENGVVVRTAGAAVEA
FT                   IS"
     atgccgggtg acatcggtta ctacctcgtc tatctgccgc tcgggacgat cggtctcgtg        60
     cggtggctgt gctggctggc ccgccgtatc ccggccgcgc tgtaccggcc ggtgggtggc       120
     gacctgcgac tgccgctgac cgtcgtcgtg cccgtctacc aggaggaccc ggaggtcttc       180
     acccgggcgc tgacgtcctg gctggcgaac gacgtcgacg aggtcatcct cgtcatcgac       240
     gccaccgaca ccgcgtgccg ccggatcgcg gccgacttcc cggtgaccgt tctcgtcacc       300
     gaagtccctg gaaaacgtga cgcgctgcgc cgcggctggg aggcggcgag caccgagctg       360
     gtcgcgctgg tcgactcgga caccatctgg gcggacgacg tcgccgccga ggtgtgcaaa       420
     ccgttcgccg acccggccgt cggcggggtg gccacccggc agaacgtgta caacccgcgc       480
     ggttttctgc agcggatcac cgacctgttc ctcgactgcc ggtacttcga cgagaacgcg       540
     gcccagtccg tgatgggccg cgcgctgtcc tgcctgtcgg gtcgtacggc gatctaccgg       600
     cgcgctctgc tcgtcgaggt cagccacgag ttcatgaccg agaagttcct cggggtccag       660
     tgcatgtccg gcgacgacaa gcggctgacc acgctgctgc tggagcgggg ccacgcgacc       720
     gtgctccagc gctcggcccg ggtctggtcc agcttcccgg acacctggcg gctcttctgc       780
     cggcaacggc tgcggtgggc gcgcaacacc tggcggtccg acctgcgggc gctgtcacgg       840
     cgctgggtgt ggcgccggcc gttcctggcg ttctcgatgg tcgagaaggc ggtcagcggt       900
     ttcaccctgc tggtctcgcc gacgttcatg acgctcgcgc tcctgcgcca ccactggttc       960
     ttctgtggct gcctggcctg ctggtggtgg ctgagccggg ccgcgaaggc gctgccgcac      1020
     ctgcgccggc agccgtcgtc gttcttcctc atccccggct ggattctcgt ctccttcgcg      1080
     atgtcagtga tcaagatagg cgcgctggtg accgtgcgac gccagcgctg gctcacccgc      1140
     caggtggcgg tcgagaacgg ggtggtggtg cgcacggccg gggcggccgt cgaggcgatc      1200
     tcatga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page