(data stored in ACNUC7421 zone)

EMBL: CP002299.PE156

CP002299.PE156       Location/Qualifiers
FT   CDS_pept        204649..206445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_0614 membrane protein, IniB"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78244"
FT                   /db_xref="GOA:E3J4S5"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S5"
FT                   /inference="similar to AA sequence:KEGG:MMAR_0614"
FT                   /protein_id="ADP78244.1"
FT                   /translation="MSRARRPRVRGSRWFPPGPARSLAAAAVVAGLVLAPAATALAGTA
FT                   QARVPPDHRLVLGASRVDVLLDGRLVSRVVRPPGVVEISWLVGRVPADWVAGSGDGTVR
FT                   LKAELSLGRGAALEVGPRTSRLELVGGADPRASSGISVQGGTLQLLGTTVASVDPRTGR
FT                   PVPAGLPGRPWLSAGAGGRVDLRDSRVTGLGDGTTGARSAGLFLGPGATGSVLRSTFAG
FT                   NGIGLVLAQTQAVSLSGVTVTGSVSDGLLLRGDAGTTLAAVTSTDNGRDGVVILGGDGR
FT                   RLGGLRTEHNQRFGVRAARLRDLELTGLRSVDDTEGALLLVGCRSCVLDDPGVQGGRVG
FT                   LRIGAASGPVRVGGGVVRGAAFGVQLAPTAGQVTLTGLTVNGATRVGVEIGGSGAALHG
FT                   VQVSQAGVGVRVYGQAAGALLDQVTVTGGRDGIVATDGTRGLTVTGPTVTGVSGTGLRL
FT                   ASTGLTVRSGTVRDAAVGAALPGAGHLAGLRISGVARGIWVGERGRITAQGVDVLAART
FT                   GIEVDRGGTFDLSSSRVVAARALVGEIDRHGANTIALPPFPWFGLAALVAVLLAFGLEA
FT                   LHRVRAGRSGPPRAPDHVLNIT"
     atgagccggg cccggcggcc acgggtgcgc ggctcccggt ggttcccgcc gggcccagcc        60
     cggtcgctgg ccgcggcggc ggtcgtggcg ggcctcgtgc tcgccccagc ggccaccgcg       120
     ctggcgggga ccgcgcaggc gcgcgtcccg ccggaccatc ggctggtcct cggcgcgagc       180
     cgggtggacg tcctgctcga cggccggctg gtgagccggg tggtgcggcc gccgggagtc       240
     gtcgagatca gctggctggt cggccgggtg ccggccgact gggtcgccgg cagcggcgac       300
     gggacggtcc ggctgaaggc cgagctcagc ctcggtcggg gagccgcgct cgaggtcggg       360
     ccgcgcacga gccggctcga gctggtcggg ggcgccgacc cgcgggcgag ttccgggatc       420
     tccgtccagg gcggcaccct gcagctgctg gggacgaccg tcgcgtcggt cgacccgagg       480
     accggccgcc cggttccggc tggcctgccc ggccggccct ggctgtcggc cggcgccggc       540
     ggccgggtcg acctgcgcga cagccgggtg accggcctgg gcgacgggac gacgggggcg       600
     cggtccgcgg ggctgttcct cggccctggc gcgaccggct cggtgctgcg gtcgaccttc       660
     gccggcaacg ggatcggcct ggtgctggcg cagacccagg cggtcagcct gagcggggtc       720
     acggtgaccg gctcggtgag cgacggactg ctgctgcgcg gcgacgccgg cacgacgctg       780
     gccgcggtga ccagcaccga caacggtcgc gacggtgtcg tcatcctcgg cggcgacggc       840
     cggcggctcg gcggtctgcg caccgagcac aaccagcggt tcggcgtgcg cgcggcccgg       900
     ctgcgcgacc tggagctgac cggcctgcgc tcggtcgacg acaccgaggg agcgctcctg       960
     ctggtggggt gccggtcgtg cgtcctcgac gatccggggg tccagggcgg tcgggtcggg      1020
     ctgcggatcg gggccgccag cggcccggtc cgggtcggcg gtggcgtcgt gcggggagcg      1080
     gcgttcggcg tccagctggc gcccacggcc ggccaggtca cgctgaccgg cctgaccgtc      1140
     aacggcgcga cccgggtcgg cgtcgagatc ggtggctccg gggccgcgtt gcacggtgtc      1200
     caggtcagcc aggccggcgt cggcgtccgc gtctacgggc aggccgccgg cgcgttgctc      1260
     gaccaggtga cggtgaccgg cggccgggac ggcatcgtcg ccaccgacgg cacccgtggg      1320
     ctgaccgtga ccggcccgac cgtgaccggc gtcagcggca ccggcctgcg gctcgcgtcc      1380
     accgggctca ccgtgcggtc cggcacggtg cgcgacgcgg ccgtcggcgc ggccctgccc      1440
     ggcgccgggc acctggccgg gttgcggatc tccggcgtgg cacgcgggat ctgggtcggt      1500
     gaacgcggga ggatcaccgc gcagggagtc gacgtcctcg ccgcgcggac cgggatcgag      1560
     gtcgaccgcg gcggcacgtt cgacctgtcc tcgtcgcggg tggtggcggc ccgcgcgctg      1620
     gtcggcgaga tcgaccggca tggagcgaac accatcgcgc tgccgccctt cccgtggttc      1680
     ggcctcgcgg cgctcgtggc ggtgctgctc gcgttcggcc tggaagcact gcaccgggtc      1740
     cgggctggcc ggtccggtcc gccgcgcgcg ccggaccacg tcctgaacat cacctga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page