(data stored in ACNUC7421 zone)

EMBL: CP002299.PE160

CP002299.PE160       Location/Qualifiers
FT   CDS_pept        210733..211998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tga:TGAM_0589 glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78248"
FT                   /db_xref="GOA:E3J4S9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027389"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4S9"
FT                   /inference="similar to AA sequence:KEGG:TGAM_0589"
FT                   /protein_id="ADP78248.1"
FT                   /translation="MKHWLPWLGLVAFLRPLIEVFILAIGEWWFHAGFKENPGLFSRYV
FT                   IQITTVGREQDRVNEIIREIRDYPMTMNYQIWVVNEPGNDDVYPDADRVVTVPVEFECV
FT                   AQYKARALEYSRLVRQQLGYNQGDTKITFLDDDTSPTWEYLETAFAGDYDICQGVTAPR
FT                   IGYGVRPFSHFLLSHVDDLRFHNCMTYCSSFQGIFGKPLFVHGEGLTITGYTEETVTWN
FT                   WRIFASEDLTFGCNAAAKGLRWGFFHEYIQLTSPWTWQAYFKQRRRWMWGNIHAIVNRD
FT                   VLPRGAAIRIAIRYFLSLFTFFASGTSVALILTHTIDLPGWAHSLFWCSLVIWLVNFAL
FT                   SGWVNAGLRTAEQTTAQFWWNRVTQTAAAVVLSPVTATFTIVALIVTLYMGNPRSFEVI
FT                   AKTAATSGQRESSRPLVRGAAS"
     atgaagcact ggcttccgtg gctgggcctg gtcgccttcc tgcgcccgct gatcgaggtg        60
     ttcatcctcg cgatcgggga gtggtggttc cacgccggct tcaaggagaa ccccggcctg       120
     ttcagccgct acgtcatcca gatcacgacg gtgggccgcg agcaggaccg ggtcaacgag       180
     atcatccgcg agatccgcga ctacccgatg acgatgaact accagatctg ggtggtgaac       240
     gagccgggca acgacgacgt ctacccggat gccgaccgcg tcgtcacggt gcccgtcgag       300
     ttcgagtgcg tcgcccagta caaggcccgg gccctcgagt acagccggct ggtccgccag       360
     cagctcggtt acaaccaggg cgacacgaag atcacattcc tggacgacga cacgtcgccg       420
     acctgggagt acctggaaac cgccttcgcc ggcgactacg acatctgcca gggcgtgacg       480
     gcgccgcgga tcggttacgg cgtccggccg ttcagccact tcctgctcag ccacgtcgac       540
     gacctgcggt tccacaactg catgacgtac tgctcgtcgt tccagggcat cttcggcaag       600
     ccgctgttcg tgcacggcga aggcctgacg atcaccggtt acaccgagga gaccgtcacc       660
     tggaactggc gaatcttcgc ctcggaggac ctcaccttcg gctgcaacgc ggcggcgaag       720
     gggctgcgct ggggcttctt ccacgagtac atccagctga cctcgccgtg gacctggcag       780
     gcctacttca agcagcgccg ccggtggatg tggggcaaca tccacgcgat cgtcaaccgg       840
     gacgtgctgc cgaggggcgc cgcgatccgg atcgcgatcc gctacttcct cagcctgttc       900
     accttcttcg cctccggaac ctcggtggcg ctcatcctca cgcacacgat cgacctgccc       960
     ggctgggcgc attccctgtt ctggtgctcg ctggtgatct ggctggtgaa cttcgcgctc      1020
     tccggctggg tgaacgccgg cctgcgcacg gcggagcaga ccaccgcgca gttctggtgg      1080
     aaccgggtga cgcagacggc ggcggcggtg gtgctgtccc cggtcaccgc gaccttcacc      1140
     atcgtcgcgc tgatcgtgac gctctacatg ggcaacccgc gcagcttcga ggtgatcgcc      1200
     aagacggcgg cgaccagcgg gcaacgtgag tccagccggc cgctcgtccg gggggccgcc      1260
     tcgtga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page