(data stored in ACNUC7421 zone)

EMBL: CP002299.PE162

CP002299.PE162       Location/Qualifiers
FT   CDS_pept        213511..215847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0162"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rha:RHA1_ro00864
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78250"
FT                   /db_xref="GOA:E3J4T1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADP78250.1"
FT                   /translation="MPRPADLRLFAPSIPPARGADVTERGAARGADSQPAPDVLVGPVP
FT                   AAAGEPAEAERAGDQGAPEADTGAGRRAREFRPDIEGLRAVAVLLVVLGHSNLGVPGGF
FT                   VGVDVFFVISGFLITQQLLRERATRGRISFRRFYARRARRILPAAAVVIVATVLASWAW
FT                   LSPLRVRDIAWDAVYSAFSAVNLRLAHSGTDYFQSAAPPSPLQHYWSLAVEEQFYLVWP
FT                   LLLTLVTLAATAVTARRRRSAPPEAGDEGRPVPGTRPVVLVLLTVVAGSLLLSVVVTAR
FT                   SAPWAYFGGHTRAWELALGALVAVWAPAFERMGRALSSQLSWLGLAGIAVAAFAYGDST
FT                   PYPGTAALLPVGAAALVVAGGCAAPRKGAELLLGRAPLRLVGRLSYSWYLWHWPVLRIW
FT                   PEATGRPFHTGEKLAALGLSLVLAWLTYLLVENPVRTRPLLVRRPSLGLGLGGALAAAA
FT                   AGLALLVAAVDTVPGGRSSGPLRALDATGAAPTAPTAAGITTQPRFVGVGTSSLTPLIT
FT                   QSARLRALPTSLQPSLAKAGDDLGENKCRTPITSSTPIDCVAGDPNGSSTVVLFGDSHA
FT                   NQWFNALDAIAKESHWRLVPYTKGGCPPPYYPNFYLDELKRVYTECYAWRDAVFARIAA
FT                   LRPGLVVIGSEARVQAKDAGPGATTDLVRTLRATGAKVAFLEDTPFPGFQVPDCLASHP
FT                   SNVTSCMVTIQKSKIAEPQREIEDRGALAGGATLIDPLPWLCVRDQCPPIIGNAVVYAD
FT                   NSHLTGTYSTLLAPFLGPALRAVLR"
     gtgcctaggc ccgcggacct ccgcctgttc gcgccgtcca tcccgccggc ccgcggcgcg        60
     gacgtcacgg agcggggggc tgcccgcggc gcggacagcc agccggcccc ggacgtcctg       120
     gtcggcccgg tcccggcggc ggctggcgag ccggctgagg ccgagcgagc cggtgaccag       180
     ggtgcgccgg aggcggacac cggcgccggc cggcgggctc gggagttccg gcccgacatc       240
     gagggcctgc gagccgtcgc ggtgctgctg gtggtcctgg ggcattcgaa cctcggcgtc       300
     cccggcggct tcgtcggcgt cgacgtcttc ttcgtgatct ccgggttcct catcacccag       360
     cagctgctgc gcgagcgggc gacccggggg cggatctcgt tccgtcgctt ctacgcccga       420
     agggcccgcc ggatcctgcc ggcggcggcg gtggtgatcg tggcgacggt gctcgcctcc       480
     tgggcgtggc tgtcgccgct gcgcgtgcgg gacatcgcct gggacgccgt gtactccgcg       540
     ttctcggccg tgaacctcag gctggcccac agcggcaccg actacttcca gtccgccgcg       600
     ccgccgtcgc cgctgcagca ctactggtcg ctcgcggtgg aggagcagtt ctacctcgtc       660
     tggccgttgc tgctcacgct cgtgaccctg gccgccaccg cggtcacggc ccggcggcgc       720
     cgctcggccc cgcccgaggc cggcgacgag ggccggcccg tgcccggcac ccgaccggtg       780
     gtgctcgtgc tgctcacggt cgtcgccggc tcgctgctgc tcagcgtggt ggtcacggcc       840
     cggtcggccc cctgggccta tttcggcggt cacacccggg cgtgggaact ggcactgggc       900
     gcgctggtcg ccgtctgggc gcccgcgttc gagcggatgg gacgggcgct gtcgagccag       960
     ctcagctggc tgggcctggc cgggatcgcc gtcgccgcct tcgcctacgg cgacagcacg      1020
     ccctacccgg gcaccgccgc gctgctgccc gtcggggcgg ccgcgctggt ggtcgccggt      1080
     ggctgcgcgg cgcctcggaa gggggccgaa ctgctgctgg ggcgcgcgcc gctgcggctg      1140
     gtcggccggc tcagctactc ctggtacctg tggcactggc cggtgctgcg gatctggccc      1200
     gaggcgaccg gccgcccgtt ccacaccggc gagaagctgg cggcgctcgg gctgtccctg      1260
     gtgctcgcct ggctcaccta cctgctggtg gagaacccgg tcaggacccg gccgctgctg      1320
     gtccgccggc cgtcgctcgg cctgggcctt ggcggggcgc tggccgcggc ggccgccggc      1380
     ctggcgctgc tggtcgccgc cgtcgacacg gtgcccggcg ggcggtccag cgggccactg      1440
     cgggcgctgg acgcgaccgg cgcggccccc accgcgccca cggccgccgg gatcacgacg      1500
     cagcccaggt tcgtgggcgt cggcacgagc tcgttgacgc cgctgatcac ccagtcggcc      1560
     cggctgcgcg ccctgccgac cagcctgcag ccgtccctcg cgaaggccgg ggacgacctc      1620
     ggcgagaaca agtgccggac gccgatcacc tccagtacgc cgatcgactg cgtcgccggt      1680
     gacccgaacg ggtcctcgac cgtcgtgctg ttcggcgact cgcacgccaa ccagtggttc      1740
     aacgccctgg acgcgatcgc gaaggagtcg cactggcggc tcgtcccgta caccaagggc      1800
     gggtgcccac cgccgtacta cccgaacttc tacctggacg agctcaagcg ggtctacacc      1860
     gagtgctatg cctggcggga cgccgtgttc gcgcgcatcg cggcgctgcg cccgggcctg      1920
     gtcgtgatcg gctcggaggc gcgggttcag gcgaaggacg ccgggcccgg cgcgacgacc      1980
     gatctcgtcc ggacgctgcg ggctaccggc gcgaaggtcg cgttcctgga ggacacgccg      2040
     ttccccggct tccaggtgcc ggactgcctg gccagccacc cttcgaacgt gacgtcctgc      2100
     atggtgacca tccagaagtc gaagatcgcc gagccgcagc gcgagatcga ggaccgcggc      2160
     gcgctggccg gcggcgcgac gctgatcgac ccgttgccct ggctgtgcgt gcgcgaccag      2220
     tgcccgccga tcatcggcaa cgccgtcgtc tacgcggaca acagccatct caccggcacg      2280
     tactcgaccc tgctcgcgcc cttcctcggc ccagccctgc gggccgtcct gcgatga         2337
//

If you have problems or comments...

PBIL Back to PBIL home page