(data stored in ACNUC7421 zone)

EMBL: CP002299.PE163

CP002299.PE163       Location/Qualifiers
FT   CDS_pept        215844..216887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBG3070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78251"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T2"
FT                   /inference="similar to AA sequence:KEGG:CNBG3070"
FT                   /protein_id="ADP78251.1"
FT                   /translation="MTGPTRPAGRGYQARTRGSRRDRMVRGVTLVVLPALAGLAACSGG
FT                   RPQGGHGGSAPTPAPTASRSGPAAADEPTAPTSPLARFFGDDLVMRSRGSFNLDKVRLV
FT                   SSGDRCVPTYLRVRYPAGSASQLSVRNEDAPTGGAQAYLLLKSGPTDILHLSYRVRFPA
FT                   GFQFNKGGKLPGLFGGDHVAGGNIPDGSNGLSTRYMWRAGGAGEVYAYLPSSQVHGTNI
FT                   GTGSWSFPPGQWVTMQQRVRLNTPGQADGSITVWMDGRQALRVDNLLFRDSGTLQIDGL
FT                   FFSTFFGGGDTTWASPTDQYADFADFQVSPNYINDTMPAGCAPPGPTITPSLWPSSETS
FT                   DGSGPDQ"
     atgaccgggc cgacccggcc ggcgggacgc gggtaccagg cccggactcg cggctcgcgg        60
     cgcgaccgga tggtccgcgg cgtgaccctg gtcgtgctgc ccgcgctcgc cgggctggcc       120
     gcctgctccg gcggccggcc acagggcggc cacggtggct cggcgccgac gcccgcgccg       180
     acggcgtcgc gctccgggcc ggccgccgcc gacgagccga ccgcgccgac ctcgccgctg       240
     gcccggttct tcggggacga cctggtcatg cgctcccgtg gctcgttcaa cctggacaag       300
     gtgcgcctgg tctccagcgg tgaccggtgc gtgccgacgt acctgcgggt ccgctacccg       360
     gccggctcgg ccagccagct ctcggtccgc aacgaggacg cgccgaccgg tggggcccag       420
     gcctacctgc tgctgaagtc cggcccgacc gacatcctgc atctgagcta ccgtgtccgg       480
     ttcccggccg gcttccagtt caacaagggc gggaaactgc ctggactatt cggcggcgac       540
     cacgtggcgg gcggcaacat cccggacggc tcgaacggcc tgtccacccg ctacatgtgg       600
     cgggccgggg gcgctggcga ggtgtacgcc tacctaccgt cctcgcaggt gcacggcacc       660
     aacatcggca ccggtagctg gagttttccg ccgggtcagt gggtgacgat gcagcagcgg       720
     gttcgtctga acaccccggg ccaggccgac gggtcgatca cggtctggat ggacggccgg       780
     caggcccttc gagtcgacaa cctgctgttc cgggacagcg ggacgctcca gatcgacggc       840
     ctgttcttct ccaccttctt cggcggcggc gacaccacct gggcaagccc caccgaccag       900
     tacgccgact tcgccgactt ccaggtctcc ccgaactaca tcaacgacac gatgcccgcc       960
     gggtgcgcgc ctccgggccc gacgatcacc ccgagcctgt ggccatccag cgagacttcc      1020
     gacggctcag ggccagacca gtag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page