(data stored in ACNUC7421 zone)

EMBL: CP002299.PE164

CP002299.PE164       Location/Qualifiers
FT   CDS_pept        217202..218587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78252"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T3"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_3417"
FT                   /protein_id="ADP78252.1"
FT                   /translation="MFGFEFQTANAFVKGPFVAGVGERQVAWRHTLTKATLEGDESRRP
FT                   GATADLEFVTPAVEDLQSANAAVGALTGLAQAILDTRPVSGGIRIFKKGGQLAGGVWQA
FT                   DCAILIHDETFGAQAQGTVGVPLTGIGTLLSKVWARTAGHSDSHSQVAQEESGFFEYLS
FT                   TAIPACQEAENVEAAELYGFLTACHLFLVRATRAPLSFVSGEDLTGFHPTESKGIFDFS
FT                   DRPDVRAAAARVRGLEAPPERALVKVGSDSPKDMFQLLHRTDFHSMYLAVPEKQRKIIE
FT                   GRPVAEALWPPEWSGAEAFVFPLPYRIEAEATDTRARGLEPLTKAEWINEKAPRLERAP
FT                   VTWTLVDHGPTIGDWWTSVQKGDVRRDGIPKDAASPPPGFRGRDPKYLATFPDSSIEDK
FT                   ATFYGMGSFPIDVDKKTGIPLAVYEHRDLMADKDIPPQEKLGLAQWSTVVAVFVEHYVP
FT                   TLG"
     ttgttcgggt tcgagtttca gacggccaat gcgttcgtga aggggccgtt cgtcgccggg        60
     gtgggcgagc gccaggtcgc ctggcgacac acgcttacca aggcgacgct ggagggcgac       120
     gagtcccgcc ggccgggcgc gaccgcggac ctggagttcg tcaccccggc cgtcgaagac       180
     ctgcagagcg cgaatgcggc cgtgggtgcc ctcaccgggc tcgcccaggc gatcctggac       240
     accaggccgg tctctggcgg catccggatt ttcaaaaaag gcggccagct cgccggaggc       300
     gtctggcagg ccgactgcgc catcctgatc cacgacgaga cgttcggcgc gcaggcgcag       360
     ggcaccgtcg gcgtgccgct gaccgggatc ggcacgctgc tgtccaaggt gtgggcccgg       420
     accgccgggc acagcgattc gcattcccag gtcgcccagg aggagagcgg attcttcgag       480
     tacctgagca ccgcgattcc cgcctgtcag gaggccgaga acgtggaggc cgccgagctt       540
     tacggtttcc tgaccgcgtg ccatctgttc ctggtccggg ccacccgcgc gccgctgtcg       600
     ttcgtgtccg gcgaggacct gacggggttt cacccgaccg agagcaaggg catcttcgac       660
     ttcagcgacc gccccgatgt ccgggcggcg gcggcgcggg tgcgcggtct ggaggcgccg       720
     cccgagcgcg cactggtgaa ggtcggttcc gactcgccga aggacatgtt ccagctccta       780
     caccgcaccg acttccactc gatgtacctg gcggtgccgg agaaacagcg gaagatcatt       840
     gaagggcgcc cggtcgccga ggcgctgtgg ccgccggaat ggagcggcgc cgaggcgttc       900
     gtgttcccgc tgccgtaccg gatcgaagcc gaggcaacgg acactcgggc ccgcggcctc       960
     gaaccgctga ccaaggccga atggatcaac gagaaggcgc ccaggctgga gcgcgcgccc      1020
     gtcacctgga cgctcgtcga ccacggcccc accatcggcg actggtggac gtcggtgcag      1080
     aagggcgacg tgcgccggga cggtatcccg aaggacgccg cctcaccgcc gcccggcttc      1140
     cgcgggcggg acccgaaata cctggccaca ttccccgact cgtccatcga ggacaaggcg      1200
     accttctacg ggatgggttc cttccccatc gacgtcgaca agaagacggg catcccgctc      1260
     gccgtgtacg agcaccgcga cctcatggcg gacaaggaca tcccgccgca ggagaagctc      1320
     ggcctcgccc agtggtcgac ggtcgtcgcg gtgttcgtcg agcactacgt gccgaccctc      1380
     ggctga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page