(data stored in ACNUC7421 zone)

EMBL: CP002299.PE166

CP002299.PE166       Location/Qualifiers
FT   CDS_pept        complement(219571..220494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0166"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   fal:FRAAL6675 putative secreted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78254"
FT                   /db_xref="GOA:E3J4T5"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4T5"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADP78254.1"
FT                   /translation="MQLRAPASARARRLVALGVVSLFVTIATLLTACQPPTVANAATGS
FT                   STRKPLTRDQPLTIVALGDSYSSGEGNAPFDTDAATCHRSASAWPRLLGQQLTGSTVKL
FT                   LACSGAKTYSLTSAFHGQSAQITALKSLLSAGVHPDVVTITIGGNDAGFGPTIASCVVW
FT                   RCFWTGHDNNSVQFVENQLPGLLQTAYQGVKAAAPNARILVVGYPDIFPSRSDNTCKWM
FT                   DSTERVQLVGLNDDLDRVAKRAAGKAGVEFVSTANTLNGHRLCTTDSWLYPVELLGAGT
FT                   TASAHPNAQGEQAIADAVYGYLFKGK"
     atgcagctgc gtgcgcccgc ttcggcgcgg gctcgtcgcc tcgtcgcgct gggtgtcgtc        60
     agcctcttcg tgaccatcgc gaccttgctc accgcctgtc agcccccgac ggtcgcgaac       120
     gccgccaccg gatcgtcgac gcggaaaccg ttgacccgcg accagccgct gacgatcgtg       180
     gccctcggcg actcgtactc ctcgggtgag ggcaacgcgc cgttcgacac tgacgcggcg       240
     acctgtcacc gcagcgccag cgcgtggccg aggttgctcg gccagcagct gaccggctcg       300
     acggtgaagc tgctcgcctg ttccggtgcc aagacctact cgctgacgag cgccttccac       360
     ggacagtcgg cccagatcac ggccctgaag tcgctgctgt cagcaggggt ccatccggac       420
     gtcgtgacga tcacgatcgg cggcaacgac gcgggcttcg ggccaactat cgccagttgc       480
     gtggtgtggc gctgcttctg gaccggtcat gacaacaaca gcgtgcagtt cgtcgagaac       540
     cagctgcccg gcctgttgca gaccgcctac cagggcgtga aggcggcggc cccgaacgcg       600
     cggatcctcg tcgtcggata tccggacatc ttcccgagcc gcagcgacaa cacctgcaag       660
     tggatggaca gcaccgagcg agtgcaactc gtcgggctga acgacgacct tgaccgagtt       720
     gccaagcggg ccgccgggaa ggccggcgtc gagttcgtct cgaccgccaa cacgctcaac       780
     ggccatcggc tgtgtaccac cgactcctgg ctctatccgg tggaactcct cggcgcgggc       840
     acgacggcca gcgctcaccc gaacgcccag ggcgaacagg caatagcgga cgccgtctac       900
     ggctacctct tcaagggcaa atag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page