(data stored in ACNUC7421 zone)

EMBL: CP002299.PE17

CP002299.PE17        Location/Qualifiers
FT   CDS_pept        23500..24006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78105"
FT                   /db_xref="InterPro:IPR023817"
FT                   /db_xref="UniProtKB/TrEMBL:E3J267"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6511"
FT                   /protein_id="ADP78105.1"
FT                   /translation="MTRDLVKGLAEVAENGEHGTAAGGAVPERRDSSPGVVATPWDGDD
FT                   WALVVGSGSDLAELYDGIAGLPTGLAFVEAFGDVDLVLVYRPAGTASTSAGPLDALVDQ
FT                   AVRHGGTLVGSGGPNGLSTGEQYRTSAERAAFAAGQADALGRMRRALTGEADARPNGHG
FT                   VPIAS"
     atgacgcggg acctcgtgaa aggcctggca gaagtcgctg agaacggcga acacgggacc        60
     gcggccggcg gtgcggtgcc cgaacggcgg gactcgtcgc ccggggtcgt cgctacgccg       120
     tgggacggcg atgattgggc actcgtcgtc ggatcgggct cggacctcgc ggagctgtac       180
     gacggaatcg cggggctccc gacgggcctg gcgttcgtcg aagcattcgg cgatgtcgat       240
     ctcgtcctgg tctaccggcc cgcgggcacg gcgtcgacgt cggccggccc gctcgacgcg       300
     ctcgtggacc aggcggtgcg gcacggcggc acgctcgtcg gctccggcgg tccgaacggt       360
     ctgtcgaccg gcgagcagta ccgaacctct gcggaacggg ccgcgttcgc cgctgggcag       420
     gccgacgcgc tcggcaggat gcgacgcgcg ctgacgggag aggccgacgc acggcccaac       480
     ggccacggtg tgccgatcgc gtcgtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page