(data stored in ACNUC7421 zone)

EMBL: CP002299.PE174

CP002299.PE174       Location/Qualifiers
FT   CDS_pept        232843..235824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssc:100049648 basic proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78262"
FT                   /db_xref="GOA:E3J4U3"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U3"
FT                   /inference="similar to AA sequence:KEGG:100049648"
FT                   /protein_id="ADP78262.1"
FT                   /translation="MSDAGSGPKAGPETDEAKAATRGSSETPGGRGHSPSPAEPEASRG
FT                   VSTRRRTEPGRGETPAEGSARVDEGSQTIKLPPGQNPAPSPPSVYSRAAVRVAVDETTT
FT                   TPRPGGGPREPTAPPAPPSVYTSTPPRGARRPEAPGERTTRVERPRPERRDTVDPAAPP
FT                   ASGSSPAGERTTRVDRSRVERRDTVDPAAPRTPGRGAGVPAAGSAAPSAEHTARVDRSR
FT                   VTRRDTVDDPAAVTSRGAGPPKAPPPDSTELLDRRKIAGATSGDRPSAAAAGRAATDRA
FT                   STGGAPTDRAATDRAAAGRVATDRASTDRASTDRAAGGRAPAERAVTQATRPVGHRAAT
FT                   PEPNPAETTMRISRRDLPGGRQGRMALLADPSMAETTIHMSRSAMPPGSLLFQTGPVPI
FT                   PLREELTAAAPTPPAEESESQAPSLLRRVPAGLIDSSLSSMGSFLMGLFAQYFLPAATL
FT                   GTYGLFYQAFIAVSVIPTGIVFSPVEYTSAGVAARRRRVQLLPQSLQLGMAPAILAALL
FT                   VPFVLIIPSDGQSVGSRVGFAVTAALVAVASPMQDHIRRMLHQAGMSWTAAATSLVQVV
FT                   TVAVGLVVAKVAHVPPAWVPFGALAVANLVSGAFALWKGKPGNRAPMLLKLRSLFALGG
FT                   WIVVGNVLSASGPFINFALLTALANSTDVGNGEGSRVLAQPVTVLVIGLLAVLNPEIME
FT                   AAHNRAVRKLIKICLLFWGMVAVAILAWALLVGFEWPFNPLPRFQKPAYEVHGLLPWTI
FT                   ITEGAGYSVLVLITIANAAGRARAASVASLVAVVVSGVAVAATAKHFGPFALIWGAGAT
FT                   VVAMYAVNGAVVLNEFRRPARPAAAAPSAAAEPPVRPASAPPSRPMAGPARPVPGQARP
FT                   VPGSARPGPASGRPAPASGRPVPGPGGPAMPGQGRPAAPGPVPARLPPAGTRPDDAPTR
FT                   RGPLPAPPPAAPPRPPAPAPAPAPQPQPQPVAEQPAPAPRGGRGRHSRGGSGLRRPDVF
FT                   DRKR"
     atgagcgacg ctgggagtgg tcccaaggcg ggtccggaga cggacgaggc caaggcggcc        60
     accaggggga gcagcgagac gccgggcggg cgcggacact ccccgtcacc agccgagccg       120
     gaagcgtcgc gaggggtctc cacgcggcgg cggacggaac caggccgtgg cgagacgcct       180
     gccgagggct ccgcccgggt cgacgaaggc agccagacca tcaaactgcc gcccgggcag       240
     aacccggcgc cgtcgccgcc gtccgtctac tcccgggccg cggtccgggt ggcggtcgac       300
     gagacgacga ccacaccccg ccccggcggg ggccctcgcg agcccaccgc gccgccggcc       360
     ccaccgtcgg tctatacgtc cactccgccc cgcggggccc ggcgacccga ggcccccggc       420
     gaacggacca cgcgggtgga acggccccgg cccgaacggc gtgacaccgt cgatccagcc       480
     gcgccgccgg cgagcggaag ctcgccggcc ggcgagcgga cgaccagggt cgaccggtcg       540
     cgggtcgagc gccgggacac ggtcgatccg gccgcgccgc ggacaccggg acgtggcgcg       600
     ggcgtgccgg ccgccgggtc cgccgcgccc tcggcggaac acaccgcgag ggtcgaccgg       660
     tcgcgggtga cgcggcggga caccgtcgat gacccggcgg ccgtgacgag ccgcggcgcc       720
     ggcccgccga aggcgccgcc gccggacagc acggagctgc tcgaccgccg caagatcgcg       780
     ggagccacgt ccggtgaccg gccctccgca gccgccgctg gccgagccgc gaccgaccga       840
     gcgtcgacgg gcggcgcccc gaccgaccgg gccgcgaccg accgggccgc tgctggccga       900
     gtggcgaccg accgcgcttc gaccgaccga gcgtcgaccg accgcgccgc gggtggtcga       960
     gcgccggctg aacgggccgt gacccaggcc accaggcccg tcggccaccg cgccgcgacc      1020
     ccggagccga accccgccga gacgacgatg cggatctccc gccgggacct cccgggcggg      1080
     aggcaagggc gcatggccct gctcgccgac ccgtcgatgg ccgagacgac gatccacatg      1140
     tcgcgctcgg cgatgccgcc gggctcgctg ttgttccaga ccggcccggt tccgatcccg      1200
     cttcgggagg agctgacggc ggccgcgccg acgccgcccg ccgaggagtc ggagtcacag      1260
     gcgccgtcgc tgctgcgccg agtgccggcc ggcctcatcg actccagcct gtcctcgatg      1320
     ggcagcttcc tgatgggcct gttcgcgcag tacttcctgc cggcggccac gctgggcacg      1380
     tacgggctgt tctaccaggc cttcatcgcc gtgtcggtca tcccgacggg catcgtgttc      1440
     tcgccggttg agtacacgtc ggcgggcgtc gcggcccggc gccggcgggt gcagctgctg      1500
     ccgcagtcgc tgcagcttgg catggcgccc gccatcctgg cggcgctcct ggtgcccttc      1560
     gtactgatca ttccgtcgga cgggcagtcg gtcggctccc gggtcgggtt cgccgtgacg      1620
     gctgccctgg tggccgtggc ttccccgatg caggaccaca tccgtcggat gctgcatcag      1680
     gcaggaatgt cctggaccgc ggcggcgacg tccctggtgc aggtcgtcac ggtcgcggtg      1740
     ggactggtgg tggccaaggt cgcccatgtg ccgccggcct gggtgccgtt cggcgcgctc      1800
     gcggtcgcga acctggtctc cggcgcgttc gcgctgtgga agggcaagcc gggcaaccgg      1860
     gcgccgatgc tgctgaagct gcggtccctg ttcgcgctgg gcggctggat cgtggtgggc      1920
     aacgtgttgt cggccagcgg cccgttcatc aacttcgcgc tgctgacggc gctggccaac      1980
     tcgaccgacg tcggtaacgg cgaggggtcc cgggttctgg cgcagccggt caccgtgctg      2040
     gtgatcggcc tgctcgcggt gctcaacccg gagatcatgg aggcggcgca caatcgcgcc      2100
     gtccggaagt tgatcaagat ctgcctgctg ttctggggca tggtcgcggt cgcgatcctc      2160
     gcctgggcgc tgctggtcgg cttcgagtgg ccgttcaacc ccctccccag attccagaaa      2220
     ccggcctacg aggtacacgg cctgctgcca tggacgatca tcaccgaggg tgcgggctac      2280
     agcgtcctgg tgctgatcac gatcgcgaac gcggccgggc gagcgcgggc cgcgtcggtc      2340
     gcgagcctgg tggccgtcgt ggtctccggc gtcgccgtcg cggcgaccgc caagcacttc      2400
     ggcccgttcg ccctgatctg gggtgccgga gccaccgtcg tcgcgatgta cgccgtcaac      2460
     ggggccgtcg tcctgaacga gttccgtcgc ccggcgcggc ctgccgccgc cgcgccatcc      2520
     gccgccgcgg aaccaccggt tcgtccggcc tcggccccac cgagccgtcc catggcgggt      2580
     ccggctcgtc cggttccggg ccaggcccgg cccgttccag gctcggctcg tcccggtccg      2640
     gcatcgggcc gtccggctcc ggcgtcgggc cgtcccgttc cggggccggg cggcccggcg      2700
     atgccagggc agggccggcc agccgcaccg ggtcccgtgc cggcccgcct gccacctgcc      2760
     ggaaccaggc cggacgacgc tcccacgcgc cggggaccgc tgcccgcgcc accgccggcc      2820
     gcgccgcccc gcccaccggc accggcaccg gcgccggcac cacagccaca gccacagccg      2880
     gtcgcggagc agcccgcccc ggcgccgcga ggtgggcgag gccggcattc ccgcggtggg      2940
     tcaggccttc gcaggcctga cgtgttcgac cgaaagcgct ga                         2982
//

If you have problems or comments...

PBIL Back to PBIL home page