(data stored in ACNUC7421 zone)

EMBL: CP002299.PE175

CP002299.PE175       Location/Qualifiers
FT   CDS_pept        236069..237046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0175"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_3994 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78263"
FT                   /db_xref="GOA:E3J4U4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP78263.1"
FT                   /translation="MTESRVPEVSIGIPVYNGADYLGTAIESHLAQTFGDFELVISDNA
FT                   STDGTEELCRGYAKEDSRVRYVRQAENIGANANFNEVVRLSRAPYYRWAADDDTLSPEY
FT                   LEKTYGLLSKDDDAVLCHSFTTYIDEDGKELRPAGDGVGFVDDKGTYVDGPDPNIATRQ
FT                   LRSPYPHVRFRDVLLHTKWCFEIFGLMRREVLLSTAMQQKFYGTDRVILAEMALLGTWR
FT                   VVEEPLWQRRSHSGASNNMSVWQKAKWSNPDAKKSLLPPVSNMIRGYIDAIDRHTFPPV
FT                   EKAQCYAAVGVLAVQPDKFRKLLVPGPHNYFGIGNKQSNAAHRL"
     atgacggaat cccgggtacc tgaggtcagc atcgggattc cggtgtacaa cggcgctgac        60
     tacctcggca cggccatcga gtcgcacctc gcgcagacct tcggcgactt cgagctggtg       120
     atctcggaca atgcctccac cgatggcacc gaggagctct gtcgcggcta cgcgaaggag       180
     gactcgcggg ttcgctacgt gcgccaggcg gagaacatcg gcgcgaacgc gaacttcaac       240
     gaggtcgtcc ggctctctcg ggctccttac taccggtggg ccgccgacga cgacacgttg       300
     tcgcccgagt acctggaaaa gacgtacggc ctgttgagca aggacgacga cgcggtcctg       360
     tgtcactcct tcaccacgta catcgacgag gacggcaagg agctgcgccc ggccggcgac       420
     ggggtcggct tcgtcgacga caagggcacc tacgtcgacg gcccggaccc gaacatcgcc       480
     acccggcagc tgcgctcccc gtacccgcat gtccggttcc gggacgtgct gctgcacacg       540
     aagtggtgtt tcgagatctt cgggctgatg cgccgcgagg tcctgctgag caccgcgatg       600
     cagcagaagt tctacggcac cgaccgcgtg atcctcgccg agatggcgtt gctggggacc       660
     tggcgggtgg tcgaggagcc gctgtggcag cgccgctcgc actcgggcgc ctcgaacaac       720
     atgagcgtct ggcagaaggc caagtggagt aatccagacg cgaagaagag cctgctgccc       780
     ccggtctcca acatgatccg cggctacatc gacgcgatcg accggcacac cttcccgccg       840
     gtcgagaagg cgcagtgcta cgccgcggtc ggcgtgctcg cggtccagcc ggacaagttc       900
     cgcaagctgc tggtacccgg gccgcacaac tacttcggta tcggcaacaa gcagtcgaac       960
     gccgcccacc ggctgtag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page