(data stored in ACNUC7421 zone)

EMBL: CP002299.PE179

CP002299.PE179       Location/Qualifiers
FT   CDS_pept        242116..243303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0179"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   stp:Strop_4490 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78267"
FT                   /db_xref="GOA:E3J4U8"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADP78267.1"
FT                   /translation="MRVLVVHNDYVSANPSGERRVVNDDLENLRAAGVDVRAYIRSSDE
FT                   IQGLTGAAKAELLVRPVYSREDTAKVAQILRDDRIDVLHLHNPYPLISPQVVRVADAAG
FT                   VAVVQTVHNYRMACVNGAFFRDGEICTKCATKRVPLPAIQHGCYRESRAQSVVMAAALT
FT                   AHRPTWQLVDRFLPVTSFMVKHLRDAGIPASQITPKPNTVHDPGPATAPGRGLLFAGRL
FT                   VEEKGIQLLLAAWDHFHRHGGGWLDELTIVGEGPLRTEVERAARALPGVRYLGPVPSEQ
FT                   VGELMRASAAVAVPSLWFEGFPMTVLEAYARGRAVVGTSVGSVGTVVDGEVGWRTAGTE
FT                   PEDLAAALAEVDALTAARRGAAARTRFETSFTPEVVTKQLVAIYEDVLALRRARP"
     gtgcgcgtac ttgtggtgca caacgactac gtcagcgcca acccgtccgg ggaacgccgg        60
     gtcgtgaacg acgacctgga gaacctgcgg gcggccggcg tcgacgttcg ggcctacatc       120
     cggtccagtg acgagatcca ggggctgacc ggcgcggcca aggccgaact gctggtccgc       180
     ccggtctact cccgtgagga cacggcgaag gtcgcccaga tcctgcgcga cgaccggatc       240
     gacgtgctgc acctgcacaa cccgtacccg ctgatctcgc cgcaggtcgt ccgggtcgcg       300
     gacgcggccg gcgtggcggt cgtccagacc gtgcacaact accggatggc gtgcgtcaac       360
     ggcgcgttct tccgggacgg cgagatctgc acgaagtgcg cgacgaagcg ggtgccgctg       420
     ccggcgatcc agcacggctg ctaccgcgag tcacgggcgc agagcgtggt catggcggcg       480
     gcgctgaccg cccaccggcc cacctggcag ctggtcgacc ggttcctgcc ggtcacgtcg       540
     ttcatggtga agcacctgcg tgacgccggc atcccggcct cgcagatcac gcccaagccg       600
     aacaccgtgc acgacccggg cccggcgacc gcgccgggtc ggggcctgct gttcgcgggc       660
     cgcctggtcg aggagaaggg catccagctg ctgctggccg cctgggacca cttccaccgt       720
     cacggcggcg gctggctgga cgagctgacc atcgtcggcg aggggccgct gcgtaccgag       780
     gtggaacggg ccgcgcgggc gctgcccggg gtgcgctacc tcgggccggt cccgagcgag       840
     caggtcggcg agctgatgcg cgcgtcggcg gccgtggccg tcccgtcgct gtggttcgag       900
     ggcttcccga tgaccgtgtt ggaggcgtac gcccgcggtc gcgcggtcgt cggcacctcg       960
     gtcggttcgg tgggcaccgt cgtcgacggc gaggtcggct ggcgcaccgc cggcaccgag      1020
     ccggaggacc tcgccgccgc gctcgccgag gtcgatgccc tcaccgcagc ccgccgtggc      1080
     gctgcggcga ggacccgctt cgagacgtcg ttcacccccg aggtcgtcac caagcagctc      1140
     gtcgccatct acgaggacgt gctggccctg cgccgcgccc ggccctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page