(data stored in ACNUC7421 zone)

EMBL: CP002299.PE180

CP002299.PE180       Location/Qualifiers
FT   CDS_pept        complement(243354..245042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_3491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78268"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4U9"
FT                   /inference="similar to AA sequence:KEGG:RPE_3491"
FT                   /protein_id="ADP78268.1"
FT                   /translation="MGAPADTTTTTWGFPARRRPRALAALTAGLAAAAVLLAACGGGHG
FT                   TPAAPGTLEQGVPTAAPTGNLATYPAPDTPYVVGAGQRYTSIQKAVDAAPEGATIYIKN
FT                   GTYRESVIPKSGQTLQGESRDGTRIDGANAVTASSWHRDGRLWYFTDPWPLRGKVAALW
FT                   DGVTPDIDALDTDLLHRDDVPLLHKAQRGQVGSGDFWIDYDSHRVYIADDPAGHRFELA
FT                   VRRVGVGDTNGTATNVNLVNLTVEKTATGFNEAGIEMKTGWTIKDCLVLGHHGRGINTE
FT                   IDNTIVGTIAPTTGSYSGSGDQASDQQGRSGSMQVLLNGDLGIGGDPHLDAAPNGNNIQ
FT                   ITNTEIGWSNVERYSYWDEAGGVKLSGRSNVSLSGDWIHDSYGAGTWFDTGNKNIKVTG
FT                   SLFEDNLAAGVWYEANDGGIEITKNTFRRNGDTDLAMNRQFDTRGQYSAIFLSDSANAT
FT                   VDQNFIQVGTHGGFGIASHYGGRIHPAHYAINGNVISIGIPTAAFAFGSDGTDIVFTDN
FT                   SVLTWGQVTPTSNLFSLGAGSFTAWQASGRDTHGIIAAVAVPPAS"
     atgggggctc ccgccgacac gaccacgacg acctggggtt ttccggcgcg ccgacggccg        60
     agagcgctcg cggcgctcac cgccgggctg gcagccgcgg ccgtcctgct cgcggcctgc       120
     ggcggcggcc acgggacgcc ggccgcgcca gggacgctcg aacagggcgt gccgacggcg       180
     gcgccgaccg ggaacctggc cacgtacccc gcaccggaca cgccgtacgt cgtcggcgcc       240
     ggtcagcggt acaccagcat ccagaaggcg gtcgacgcgg cgcccgaggg cgcgaccatc       300
     tacatcaaga acggcaccta ccgggagagc gtcatcccca agagcgggca gacgctgcag       360
     ggtgagagca gggacggcac ccggatcgac ggcgcgaacg ccgtcaccgc gtcgtcctgg       420
     caccgcgacg gcaggctctg gtacttcacc gacccctggc cgctgcgcgg caaggtcgcg       480
     gctctgtggg acggcgtcac cccggacatc gacgccctgg acaccgacct gctgcaccgc       540
     gacgacgtcc cgctgctgca caaggcccag cgtggccagg tcggctcggg cgacttctgg       600
     atcgactacg acagccaccg ggtgtacatc gcggacgacc cggccggaca ccgcttcgag       660
     ctggccgtcc gccgggtcgg cgtcggcgac accaacggca ccgccaccaa cgtcaacctg       720
     gtgaacctca ccgtcgagaa gaccgcgacc ggcttcaacg aggccgggat cgagatgaag       780
     accggctgga cgatcaagga ctgcctggtg ctcggccacc atggccgcgg catcaacacc       840
     gagatcgaca acaccatcgt cgggacgatc gcgccgacca ccgggtccta ctccggcagc       900
     ggcgaccagg cgtccgacca gcagggccgc tccggctcga tgcaggtact gctcaacggc       960
     gacctcggca tcggcggcga cccgcatctc gatgcggcgc cgaacggcaa caacatccag      1020
     atcaccaaca ccgagatcgg ctggtcaaac gtcgagcgct actcgtactg ggacgaggcc      1080
     ggcggggtca agctgtctgg ccggtccaac gtcagcctga gcggggactg gattcacgac      1140
     tcgtacggcg ccggcacctg gttcgacacc gggaacaaga acatcaaggt cacgggcagc      1200
     ctgttcgagg acaacctcgc cgccggcgtc tggtacgagg cgaacgacgg cggcatcgag      1260
     atcaccaaga acacgttccg ccgcaacggc gacaccgacc tggcgatgaa ccgccagttc      1320
     gacacccggg gccagtactc ggcgatcttc ctgtccgact cggccaacgc caccgtcgac      1380
     cagaacttca tccaggtcgg cacgcacggc ggcttcggca tcgcgtccca ctacggcggc      1440
     cgcatccacc cggcgcacta cgccatcaac gggaacgtga tctcgatcgg catcccgacg      1500
     gcggccttcg ccttcggcag cgacggcacc gacatcgtct tcaccgacaa cagtgtgctc      1560
     acctggggcc aggtcacccc gacctcgaac ctgttcagcc tcggcgcggg ctcgttcacc      1620
     gcctggcagg cttccggccg cgacacccac ggcatcatcg ccgcggtcgc ggtcccgccc      1680
     gcgagctga                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page