(data stored in ACNUC7421 zone)

EMBL: CP002299.PE186

CP002299.PE186       Location/Qualifiers
FT   CDS_pept        251641..252135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0186"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: nfa:nfa34640 putative
FT                   MutT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78274"
FT                   /db_xref="GOA:E3J4V5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADP78274.1"
FT                   /translation="MVWREYSQQHREAVAAGAPEAKLANSLVVGGSAIVVDDQGRFLLE
FT                   RRRDNGKWGIPGGGMQIGEWFEDCVVREIHEETGLDVRVDRIVGVYSNPSHVMVYADGE
FT                   RRQEFTICCACTIVGGELRASEESLDVAFVAFEDLDALDFHESGRQRITDYLAGGPPVL
FT                   R"
     gtggtgtgga gggagtactc ccagcaacat cgggaggcgg tcgcagccgg agcgcctgag        60
     gcgaagctag ccaactccct ggtcgtcggc ggcagcgcga tcgtcgtcga cgaccaggga       120
     cgctttctgc tcgaacgccg ccgtgacaac ggcaagtggg gcatccccgg cggcgggatg       180
     cagatcggcg agtggttcga ggactgcgtc gtccgcgaga tccacgagga gaccggcctc       240
     gacgtcaggg tcgaccggat cgtcggggtc tactcgaacc caagccatgt gatggtctac       300
     gcggacggtg agcgccgcca ggagttcacc atctgctgcg cctgcacgat cgtcggcggc       360
     gagttgcggg ccagcgagga gtcgctggac gtcgcgttcg tcgcgttcga ggacctcgac       420
     gccctcgact tccacgagag cggccggcag cggatcaccg actatctcgc gggtggcccg       480
     ccggtgctgc gatga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page