(data stored in ACNUC7421 zone)

EMBL: CP002299.PE188

CP002299.PE188       Location/Qualifiers
FT   CDS_pept        252887..253303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78276"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V7"
FT                   /inference="similar to AA sequence:KEGG:Krad_1844"
FT                   /protein_id="ADP78276.1"
FT                   /translation="MIPPQAGVIGESRPSLGRYPRMGIVDANDETIAELRHLVAVIDDT
FT                   IAQLERVRRRADEIEHRRVGGDLYRVIVEAEERPLIVESLSDVLDRLSSAAGRFRRAEA
FT                   TALAAEGWTHERIGQFFGVTRQRIGILLSRERVR"
     gtgatcccgc cgcaggccgg cgtgatcggc gaatcgcgcc cgtcgctcgg ccggtacccc        60
     agaatgggca tcgtggacgc caacgacgag acgatcgccg aactgcgcca tctggtcgcc       120
     gtcatcgatg acacgatcgc ccagctggag cgggtccgtc ggcgggcgga cgagatcgag       180
     caccgccggg tcggcggcga cctctaccgg gtgatcgtcg aggccgagga acggccgctg       240
     atcgtcgaga gcctcagcga cgtcctggac cggctgtcgt cggcggccgg gcgcttccgc       300
     cgggcggagg cgaccgcgct ggccgccgag ggctggaccc acgagcgcat cggacagttc       360
     ttcggggtga cccgacagcg gattggcatc cttctcagcc gcgaacgggt tcgttag          417
//

If you have problems or comments...

PBIL Back to PBIL home page