(data stored in ACNUC7421 zone)

EMBL: CP002299.PE189

CP002299.PE189       Location/Qualifiers
FT   CDS_pept        253980..254927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78277"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6244"
FT                   /protein_id="ADP78277.1"
FT                   /translation="MTTVFTDSRMPDERRRERLYGGDLFVTSPSPAVQALVDFARELIE
FT                   DAFAPYDPVVAQHELPVEKFVEIFGPLKPKFIHHPKTKGLIADVVSGLGSDLDETYIDV
FT                   PRLRGATSDGYLTAGVGYAFPLHRDVWWSAPLAQINWWLPIYDFESESSMAFHPHYWSS
FT                   GISNGSEEFNYYVYNATGRAQAAQHVAKDTRKQPGPREPVQVDPQIRVVCPVGSVIGFS
FT                   AAQMHSTVPNTSGRTRFSIDFRTVNVADLRAGRSAPNVDTQCEGTSLRDFRRGSDQAAM
FT                   PAEVVAQYDSGEIPEGAVLVFDPNAAKAPADSMA"
     atgacgaccg tcttcaccga ttccagaatg cccgacgagc gccggcggga gcggctgtac        60
     ggcggcgacc tgttcgtgac gtccccgtcc ccggccgttc aggcgctggt ggacttcgcc       120
     cgcgagctca tcgaggacgc gttcgcgccg tacgacccgg tggtggccca gcacgaactg       180
     cccgtcgaga agttcgtgga gatcttcggc ccgctgaagc cgaagttcat ccaccacccg       240
     aagaccaagg gcctgatcgc cgacgtggtc agcgggctcg gctccgacct ggacgagacc       300
     tacatcgacg ttccccggct gcgtggggcg acctccgacg ggtacctgac ggccggcgtc       360
     ggctacgcgt tcccgctgca ccgggatgtc tggtggtccg cgccgctggc gcagatcaac       420
     tggtggctgc cgatctacga cttcgagtcc gagtcgtcga tggcgttcca cccgcactac       480
     tggagctccg ggatcagcaa cgggtccgag gagttcaact actacgtcta caacgcgacc       540
     ggccgggcgc aggccgcgca gcacgtcgcc aaggacaccc gcaagcagcc cggcccgcgc       600
     gagccagtcc aggtcgaccc gcagatccgg gtcgtgtgcc cggtcggcag cgtcatcggc       660
     ttctcggccg cgcagatgca ctcgaccgtg ccgaacacct ccggccgcac ccggttcagc       720
     atcgacttcc gcacggtgaa cgtcgccgac ctgcgggccg gtcgctcggc gccgaacgtc       780
     gacacccagt gcgagggcac cagcctgcgc gacttccggc gcggcagcga ccaggctgcg       840
     atgcccgcgg aggtcgtcgc ccagtacgac agcggcgaga tccccgaggg cgccgtcctg       900
     gtgttcgacc cgaacgccgc caaggccccc gccgactcga tggcctag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page