(data stored in ACNUC7421 zone)

EMBL: CP002299.PE190

CP002299.PE190       Location/Qualifiers
FT   CDS_pept        complement(254988..255899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0190"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: fal:FRAAL6667
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase); PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78278"
FT                   /db_xref="GOA:E3J4V9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4V9"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADP78278.1"
FT                   /translation="MPLTHVEFAGLTHLGSGKVRELFAVGDDAVLLVASDRISAFDVIL
FT                   PTEIPDKGAVLTGLSLWWFDQLADLVPSHVISSNVDEYPDELQPYAEQLRGRSMLCHRL
FT                   DMALVECVARGYLTGSGLKDYVRTGAVSGHTLPEGLVDGSKLPHPIYTPSTKAPIGEHD
FT                   ENISRADAATRIGDDLAAELEKLTLQIFGRASDLAAERGILLADTKFEFGHDPAGVLRL
FT                   GDEVLTPDSSRFWPADSWAPGGAQPSYDKQFIRDYLVNTGWDKVSPAPELPDDIVFSTR
FT                   SRYVEAYERLTGISFADYLATS"
     atgccgctca cccatgtgga gttcgccgga ctcacccacc ttggctccgg caaggtccgc        60
     gagctgttcg cggtcggcga cgacgccgtg ctcctggtcg ccagcgaccg gatctcggcg       120
     ttcgacgtga tccttccgac cgaaatcccc gacaagggcg cggtgctcac cggcctgtcg       180
     ctgtggtggt tcgaccagct cgccgatctc gtgccgtccc atgtcatcag ctcgaacgtc       240
     gacgagtacc ccgacgagct ccagccgtac gccgagcagc tgcgtggccg ctccatgctg       300
     tgccaccgcc tcgacatggc tctcgtcgag tgcgtcgccc ggggctacct gaccggaagc       360
     ggtctcaagg actacgtgcg caccggcgcc gtcagcggtc acaccctgcc ggagggcctg       420
     gtcgacggct cgaagctgcc gcacccgatc tacaccccgt cgacgaaggc tccgatcggc       480
     gagcacgacg agaacatcag ccgcgccgac gccgcgaccc ggatcggcga cgatctcgcc       540
     gccgagctgg agaagctcac cctgcagatc ttcggccggg ccagcgacct ggcggccgag       600
     cgcgggattc tgctcgccga cacgaagttc gagttcggcc acgacccggc cggcgtgctg       660
     cggctcggcg acgaggtcct cacccccgac tcgtcccgct tctggccggc ggactcctgg       720
     gcgcccggcg gcgcgcagcc ctcgtacgac aagcagttca tccgcgacta cctggtcaac       780
     acgggctggg acaaggtctc cccggcgccc gagctgccgg atgacatcgt cttctcgacc       840
     cggtcccgct acgtcgaagc ctacgaacgc ctcaccggca tctccttcgc cgactacctg       900
     gctacttcct aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page