(data stored in ACNUC7421 zone)

EMBL: CP002299.PE193

CP002299.PE193       Location/Qualifiers
FT   CDS_pept        complement(259974..260804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0193"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: mgi:Mflv_4758 WecB/TagA/CpsF family glycosyl
FT                   transferase; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78281"
FT                   /db_xref="GOA:E3J4W2"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W2"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADP78281.1"
FT                   /translation="MLEGGTEPRTATGTRRSAPVIREASCCGVRITACSFEDAVAAVIG
FT                   IPAKGDDEAPVTDAGSAIHLCNAYTLALADRDARLKSTLNTARFNFPDGWPVARLTRQR
FT                   TRLSEANSQKISGPDLFQAVLSAGRDHDVKHYFLGSTPEVLEALERSVRKAYPGVQIAG
FT                   VESPPFRELTPDERAEQRLRIIASGADLVWVGLGTPKQDWEVERLAAEIPAVFLAVGAA
FT                   FDFLAGLKPRAPRWMGDYGVEWIFRLVSEPKRLWKRYLVGNPQFILSVLRNRGH"
     gtgctggaag ggggcaccga gccgaggacg gcgaccggca cgcgtcgctc cgcccccgtg        60
     atccgggaag ccagctgctg cggcgtacgt atcacggcct gctcgtttga ggacgcggtc       120
     gccgcggtca tcggtattcc ggccaagggc gacgacgagg cgcccgttac cgacgccggc       180
     tcggcgatcc acctctgcaa cgcgtacacc ctcgcgctgg cggaccgcga cgccaggttg       240
     aagagcactc tcaacacggc ccggttcaac ttccctgacg gttggccggt cgcccggctg       300
     acccgccagc ggacccggct gtccgaggcg aacagccaga agatcagcgg cccggacctg       360
     ttccaggcgg tgctgtccgc cggccgcgat catgatgtga agcactattt tctgggctcc       420
     acgcccgagg tccttgaggc gctcgagcgg tcggtgcgca aggcctaccc gggcgtccag       480
     atcgccggag tggaaagccc tccgttccgc gagctgaccc ccgacgagcg ggccgagcag       540
     cggctgcgga tcatcgcgtc cggcgcggac ctggtctggg tcgggcttgg cacgcccaag       600
     caggactggg aggtcgagcg gctcgccgcc gagattcccg cggtgttcct cgcggtcggc       660
     gcggccttcg acttcctggc cggcctgaag ccgcgggccc cgcgctggat gggcgactac       720
     ggcgtcgagt ggatcttccg gctggtgagc gagcccaagc ggctctggaa gcgctacctc       780
     gtcggcaacc cgcagttcat cctctcggtc ctccgcaacc gcggccactg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page