(data stored in ACNUC7421 zone)

EMBL: CP002299.PE194

CP002299.PE194       Location/Qualifiers
FT   CDS_pept        complement(261232..262245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0194"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="KEGG: sgr:SGR_1542 putative GDP-D-mannose
FT                   dehydratase; TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78282"
FT                   /db_xref="GOA:E3J4W3"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W3"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ADP78282.1"
FT                   /translation="MTKVALVTGVTGQDGSYLCELLLQKGYEVHGLVRRSSSFNTARID
FT                   HLYQDPHEDGRKLVLHHADLDDGLSLVNILRETGPSEVYNLGAQSHVRVSYDTPLYTAN
FT                   VTGVGALRILEAVRASNLDIRVYQASSSEMFGSTPPPQNEETPFHPRSPYACAKVYAYW
FT                   SAVNHRESYGMYVSNGILFNHESPRRGETFVTRKITRAVARIQAGLQKELYLGNLDATR
FT                   DWGYAPEYVNAMWMMLQAPEPDDYVVATGTTYSVREFCQVAFGHVGLNWEDYVRFDPKY
FT                   TRPAEVDALMGDASKIRTNLGWKPEVNFEELVQIMVDGDIQLLEDERSGRLVRVDR"
     atgactaaag tcgcgcttgt tacgggcgtc acggggcagg atggctccta cctctgcgag        60
     cttttgttgc agaagggtta cgaggtccac ggcctcgtcc gccgctcgtc cagcttcaac       120
     accgcgcgta tcgatcacct gtaccaggac ccgcacgaag acgggcgcaa gctggtgctg       180
     caccacgcgg acctcgacga cggcctgagc ctggtgaaca ttctccggga gaccgggccg       240
     agcgaggtgt acaacctcgg cgcgcagagt cacgtgcggg tctcctatga cacaccgctc       300
     tacaccgcga acgtgaccgg tgtgggtgcg ctgcggatcc tggaagcggt tcgcgcgagc       360
     aacctggaca tccgcgtgta ccaggcgtcc tcgtcggaga tgttcggctc gacgccgccg       420
     ccccagaacg aggagacgcc gttccacccg cgcagcccgt atgcctgcgc caaggtctac       480
     gcgtactggt cggcggtcaa ccaccgcgag tcgtacggga tgtacgtctc gaacggaatc       540
     ctgttcaacc acgaaagccc ccgccgcggc gagacgttcg tcacgcggaa gatcactcgt       600
     gcggtcgcgc gcattcaggc tgggctccag aaggagctgt acctcggcaa tctcgacgcg       660
     acccgcgact gggggtacgc gcccgagtac gtcaatgcga tgtggatgat gctgcaggcg       720
     ccggagccgg acgactacgt ggtcgcgacc ggcaccacgt attcggtcag ggagttctgc       780
     caggtcgcgt tcggccacgt cgggctgaac tgggaggact acgttcggtt tgatccgaag       840
     tacacccgcc cggccgaggt cgacgcgctg atgggtgacg ccagcaagat caggaccaac       900
     ctggggtgga agcccgaggt gaacttcgaa gaactcgtac agatcatggt tgacggagac       960
     atccagctgc tcgaggacga gcggtcgggt cgactcgtgc gcgtcgaccg gtag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page