(data stored in ACNUC7421 zone)

EMBL: CP002299.PE2

CP002299.PE2         Location/Qualifiers
FT   CDS_pept        2876..4039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: fal:FRAAL0004 DNA
FT                   polymerase III, beta chain; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78090"
FT                   /db_xref="GOA:E3J252"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3J252"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP78090.1"
FT                   /translation="MKFRVERDEFTEAVAWTARSLPSRSATATNQQVLMGLLLDATGPG
FT                   LVVAAFDYEVAAQATLEATVHEEGRALAPGRMLADITKQLPAAPVEVETDDNKLVITCG
FT                   NARFTLQTLPVDEYPTLPPLPPITGHIEGGAFGAAVAQVAVAAGKDDTLPVLTGVRLEI
FT                   EGDTLTLAATDRYRLAVRTLKWSPSSPDAAGVALIPARTLLDTARSLGGGTAQVAIALG
FT                   TGPSGEALAGFAGNHRQTTTRLVDGQFPPYRKLLPDSCPLTAQAEKGPLLEAVKRVALV
FT                   APKTAPVRLAFSADHLRLEAGSHGGEAQASETLPATYDGPDLEVAFNPAYLQDALTAVE
FT                   SDQVEFGFASAEDAEVAAKKPAILTGKGAGDELPDYRYLLMPIQLNG"
     atgaagttcc gggttgaacg ggacgagttc accgaagcgg tcgcctggac cgcgcgcagc        60
     ctgccgagcc gttcggcgac agcgaccaac cagcaggtgc tgatgggcct gctgctggac       120
     gcgaccgggc cgggcctggt ggtggccgcc ttcgactacg aggtcgccgc gcaggccacg       180
     ctggaggcga ccgtccacga ggagggccgc gcgctggcgc cgggccggat gctcgcggac       240
     atcaccaagc agctgccggc cgcgccggtc gaggtcgaga ccgacgacaa caagctggtc       300
     atcacctgcg gcaacgcccg cttcaccctg cagacgctgc ccgtcgacga gtacccgacg       360
     cttcccccgc tgccgccgat caccgggcac atcgagggag gcgcgttcgg cgccgccgtc       420
     gcccaggtcg cggtggccgc gggcaaggac gacacgctgc ccgtgctgac cggtgtgcgg       480
     ctggagatcg agggcgacac cctgacgctc gcggccaccg accgctaccg gctcgcggtc       540
     cgcacgctca agtggagccc gtcgagcccc gacgccgccg gggtcgcgct catcccggcg       600
     cgcaccctgc tggacacggc acgctcgctc ggcggcggta cggcccaggt cgcgatcgcg       660
     cttggtacgg gtccgtccgg ggaggcgctc gccggcttcg cgggcaacca ccgccagacc       720
     acgacccggc tcgttgacgg ccagttcccg ccgtaccgca agctgctgcc cgactcgtgc       780
     ccgctgaccg cccaggccga gaagggcccg ctgctggagg ccgtcaagcg ggtcgcgctg       840
     gtggcgccga agacggcccc ggtgcggctg gcgttcagcg ccgaccacct gcggctcgag       900
     gccggtagcc acggcggcga ggcgcaggcc tccgagacgc tgcccgccac ctacgacggc       960
     cccgacctgg aggtcgcgtt caacccggcc tacctgcagg acgcgttgac ggcggtcgag      1020
     tccgaccagg tcgagttcgg cttcgccagc gccgaggacg ccgaggtcgc ggccaagaag      1080
     ccggcgatcc tgacgggtaa gggcgccggc gacgagctgc cggactaccg ctacctgctc      1140
     atgccgatcc agctgaacgg ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page