(data stored in ACNUC7421 zone)

EMBL: CP002299.PE20

CP002299.PE20        Location/Qualifiers
FT   CDS_pept        25064..25411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_0352 adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78108"
FT                   /db_xref="UniProtKB/TrEMBL:E3J270"
FT                   /inference="similar to AA sequence:KEGG:Arad_0352"
FT                   /protein_id="ADP78108.1"
FT                   /translation="MSGRAVKSRTRLSSHLSVCGGASVHLNVYPERSPILTLTTGDVSV
FT                   TIAMSTTDLDGTAMQFVRELADAAARFAEDCARFALNADPDAGPAAGPVNPPTGLASPP
FT                   SVGRSRGSRAA"
     gtgagcggcc gtgcggtcaa gtcgcgtacc cggctgtcgt cgcacctgtc ggtgtgtggc        60
     ggggcgtcgg ttcacctcaa cgtctacccg gagcggtccc cgatcctgac cctgaccacg       120
     ggggatgtgt cggtgacgat cgcgatgtcg accactgacc tggacgggac ggcgatgcag       180
     ttcgtccgtg agctcgcgga cgcggcggcc cggttcgccg aggactgcgc ccgattcgcc       240
     ctcaacgccg accctgacgc cggcccggcg gcgggaccgg tcaatccgcc gaccggactg       300
     gcctcgcccc cgtcggtggg tcgttctcgg ggttcacgcg ccgcttag                    348
//

If you have problems or comments...

PBIL Back to PBIL home page