(data stored in ACNUC7421 zone)

EMBL: CP002299.PE201

CP002299.PE201       Location/Qualifiers
FT   CDS_pept        complement(270209..270640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0201"
FT                   /product="protein of unknown function DUF3151"
FT                   /note="PFAM: protein of unknown function DUF3151; KEGG:
FT                   fal:FRAAL6659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78289"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4X0"
FT                   /inference="protein motif:PFAM:PF11349"
FT                   /protein_id="ADP78289.1"
FT                   /translation="MTSPSGRPDLLGGPPATLLPTEPGATALAAGKAAVDVAAEFPASS
FT                   AAWAALAEGALDGGRAVEAYAYARTGYHRGLDVLRRSGWRGHGPVPWSHEPNRGFLRAL
FT                   AALGRAADAIGETEEVTRIRAFLVDCDPSAPDQLGPLAP"
     atgacctctc cctccggccg gccggacctg cttggtgggc caccggcgac gctgctgccg        60
     accgagcccg gtgccaccgc gctggccgcc ggcaaggcag ccgtcgacgt cgcggccgag       120
     ttccccgcgt ccagcgcagc ctgggcggcc ctcgccgaag gcgcgctcga cggcggccgc       180
     gcggtcgagg cctacgccta cgcccgcacc ggctaccacc gcgggctgga cgtgctgcgc       240
     cggtccggtt ggcgcgggca cgggccggtc ccctggtcgc acgagccgaa ccgcggcttc       300
     ctgcgcgcgc tggccgcgct cggccgggcc gccgacgcca tcggcgagac cgaggaggtc       360
     acgcggatcc gcgccttcct ggtcgactgc gacccgagcg caccggacca gctcggcccg       420
     ctcgcaccct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page