(data stored in ACNUC7421 zone)

EMBL: CP002299.PE203

CP002299.PE203       Location/Qualifiers
FT   CDS_pept        complement(272171..272983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0203"
FT                   /product="Transglycosylase-like domain protein"
FT                   /note="KEGG: fal:FRAAL6657 N-acetylmuramoyl-L-alanine
FT                   amidase (autolysin); manually curated; PFAM:
FT                   Transglycosylase-like domain protein; Peptidoglycan-binding
FT                   domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78291"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:E3J600"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ADP78291.1"
FT                   /translation="MSGGHCAPPTACRAHAGNASVRDTSTRHHRPATARIADTPDRPHR
FT                   SATPVRKEPRRALTHPTRRIRQGIAAVPVIVAAVGGAIAVATPASASSTWAQLRQCESG
FT                   GNYSANTGNGYYGAYQFSQGTWASLGYSGLPSDAPQAVQDEAALRLAQRSGFGQWPLCG
FT                   RGMGADQLAPGASASAVPQASRSANRTSLAAPAVNTTAQLPFTTALVGQYRADVAHWQE
FT                   RMTAIGYPLAVDGSYGPVSAAAARQLQAAKGLVVDGVVGPQTWAATFA"
     atgtccggcg ggcactgtgc cccgccgacg gcctgccgcg cacacgccgg caacgcaagc        60
     gtgcgagaca ccagcaccag gcaccaccgg ccggcgaccg ctcggatcgc cgacaccccg       120
     gaccggccgc accgctcggc cacgccggtc cggaaggaac cccgacgggc attgacccac       180
     ccaacccgcc ggatacgaca gggcatcgcc gcagtgcccg taatcgtggc ggcggtaggc       240
     ggcgcaatcg ccgtggcgac tcctgccagt gcttcttcaa cgtgggcgca gctgcgccag       300
     tgcgagtccg gcggaaacta ttccgccaat accggcaacg gttattacgg cgcataccag       360
     ttctcgcagg ggacctgggc gagcctggga tattcaggac tgccgagtga cgcgccacag       420
     gcggttcagg acgaggccgc actgcggttg gcgcagcgtt ctggattcgg ccaatggccg       480
     ctctgcggcc gcggcatggg cgccgaccag ctcgcgccgg gggccagcgc gtccgccgtg       540
     ccccaggctt cccggtcggc caacagaacc tccctggcgg cgccggcggt caacacgacg       600
     gcacagctgc cgttcacgac ggccctggtc gggcagtacc gcgccgacgt cgcccactgg       660
     caggagcgga tgaccgcgat cggctacccg ctcgccgtcg acggcagcta tggcccggtg       720
     tcggccgccg cggcccgtca gttgcaagcc gcgaagggcc tggtcgtcga cggcgtcgtc       780
     ggcccgcaga cctgggccgc gaccttcgcc tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page