(data stored in ACNUC7421 zone)

EMBL: CP002299.PE204

CP002299.PE204       Location/Qualifiers
FT   CDS_pept        complement(274806..275837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0204"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: fal:FRAAL6655 fructose-bisphosphate aldolase;
FT                   TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78292"
FT                   /db_xref="GOA:E3J601"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3J601"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADP78292.1"
FT                   /translation="MPIATPDVYAEMLDRAKAGAFAYPAINVTSSQTLNAALRGFADAG
FT                   SDGIVQVSTGGAEYLSGPTVKNMVLGAEALAEFAHHVAKAYPVQIALHTDHCPADKLDT
FT                   YMRPLVAISRERVKAGRNPLFQSHMWDGSAVPLEENLKLAEELLADCKAANIVLELEIG
FT                   VVGGEEDGVVGAIDEKLYTTPEDMWRTAEVLGTGEKGRYMMAATFGNVHGVYKPGNVKL
FT                   RPTILRDGQQYVAGKLGLAGDAKPFDLVFHGGSGSDLSEIREALDYGVVKMNVDTDAQY
FT                   AFTRPVADHMLKNYDGVLKVDGEVGIKKTYDPRTWGKSAEANMAKRVVQACEDLRSAGT
FT                   AIG"
     atgcccatcg ccacaccaga cgtctacgcc gagatgctcg accgggcgaa ggcgggcgct        60
     ttcgcctacc ccgccatcaa cgtcacgtcg tcccagaccc tcaacgcggc actgcgtggc       120
     ttcgcggacg caggcagcga cggcatcgtc caggtgtcca cgggcggagc cgagtacctg       180
     tccggcccga cggtgaagaa catggtgctg ggcgccgagg cgctggccga gttcgcccac       240
     cacgtggcga aggcctaccc ggtacagatc gccctgcaca cggaccactg cccggcggac       300
     aagctcgaca cctacatgcg gccgctggtc gccatctcca gggagcgggt caaggcgggg       360
     cgtaacccgc tgttccagtc gcacatgtgg gacggctcgg ccgtgccgct ggaggagaac       420
     ctcaagctcg ccgaggagct gctcgccgac tgcaaggccg cgaacatcgt cctggagctc       480
     gagatcggcg tcgtcggcgg cgaggaggac ggcgtcgtcg gcgcgatcga cgagaagctc       540
     tacacgactc ccgaggacat gtggcgcacc gccgaggtgc tcggcaccgg tgagaagggc       600
     cgctacatga tggccgccac cttcggcaac gtgcacggcg tctacaagcc gggcaacgtc       660
     aagctgcgcc cgacgatcct gcgcgacggc cagcagtacg tcgccggcaa gctcggcctc       720
     gccggcgacg cgaagccgtt cgacctggtc ttccacggcg gttccggctc ggacctgtca       780
     gagatccgcg aggcgctcga ttacggcgtg gtcaagatga acgtggacac cgacgcccag       840
     tacgccttca ctcggccggt agcggaccac atgctgaaga actacgacgg cgtgctgaag       900
     gtcgacggcg aggtcggcat caagaagacc tacgacccgc gcacctgggg caagtcggcc       960
     gaggccaaca tggccaagcg cgtggtccag gcgtgcgagg acctccgctc cgccggcacc      1020
     gcgatcggct ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page