(data stored in ACNUC7421 zone)

EMBL: CP002299.PE206

CP002299.PE206       Location/Qualifiers
FT   CDS_pept        277461..278696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0206"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   fal:FRAAL6652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78294"
FT                   /db_xref="GOA:E3J603"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J603"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78294.1"
FT                   /translation="MARVVVTGAAGFVGGAIAHALRGRGDDVVALDVARGPGVHAADVS
FT                   RPGDWEKELVGADLVVHAAAVGMGGVGELPPIRAGRPAGSSRVPAAQMRQVLLGGTATV
FT                   LDAAARGRVGRVIHLSCVSALGPDLADGVDETAPVGLTGDPRADTLAAAEQAVGAATAS
FT                   GLPATILRLGDAYGPRAGRWTVWPVLLLRAGRFVLLDGGTGWLNPVHIDDVVAAAIAAA
FT                   GSEAAVGEVLHVTGPEPATVAEFVGCYSRMLDLPAPRSVPARMYGALDDATHAVGRLRG
FT                   RVESRRQASGEPEPTAAGRPEHGAADRAGVPAVGAAEHPDATGPSTGAVALGLVRGIGS
FT                   RLAAGVDPRQRMDLGPLAVADVTRSGRLAGDRITAVTGWQPRVDLADGMGRTETWLRDR
FT                   GLLGVNEPSRTR"
     ttggctcggg tggtggtgac tggcgccgcg gggttcgtcg gcggcgcgat cgcccacgcc        60
     ctgcgcgggc gcggggatga cgtcgtcgcg ctcgacgtgg cccgaggccc cggcgtgcac       120
     gccgcggacg tgagccggcc gggcgactgg gagaaggagc tcgtcggcgc cgatctggtg       180
     gtgcacgcgg ccgcggtcgg gatgggtggg gtcggggagc tgccgccgat ccgggctggc       240
     cggccggccg gatcgtcccg ggtcccggct gcgcagatgc gccaggtgct gctcggcggg       300
     accgcgaccg tcctcgacgc cgcggcccgg ggccgcgtcg ggcgggtgat tcatctctcc       360
     tgtgtctccg cgctcgggcc cgacctcgcc gacggcgtcg acgagaccgc gcccgtcggc       420
     ctgaccggcg atccgcgtgc cgacacgctc gccgccgccg agcaggcggt cggcgccgcg       480
     accgcgtccg gactgcccgc gacgatcctg cgactgggcg acgcctacgg gccccgcgcc       540
     ggccggtgga ccgtgtggcc ggttctgctg ctgcgcgcgg gccggttcgt cctgctcgac       600
     ggtggcacgg gctggctgaa cccggtgcac atcgacgacg tggtcgccgc ggcgatcgcc       660
     gccgccggca gcgaggccgc cgtcggcgag gtgctgcacg tgaccggacc tgagccggcc       720
     accgtcgccg agttcgtcgg ctgctacagc cggatgctcg acctgccggc cccgcggtcg       780
     gtgccggccc ggatgtacgg cgcgctcgac gacgcgacgc acgcggtcgg ccggctgcgt       840
     ggccgggtcg agtccaggcg ccaggcgtcc ggcgagcccg agccgacggc cgccggccgg       900
     cccgagcacg gtgccgccga ccgggcgggc gtgcccgcgg tgggcgcggc cgagcacccc       960
     gacgcgaccg ggccgtcgac cggagccgtg gcgctcgggc tggtccgtgg gatcggatcc      1020
     cggctggcgg caggggtcga cccgcgccag cggatggatc tgggcccgct tgccgtggcc      1080
     gacgtgacga ggtccggccg gctcgccggg gaccggatca ccgccgtgac cggctggcag      1140
     ccccgcgtcg acctcgccga cgggatgggc cgcaccgaga cgtggctgcg ggaccggggc      1200
     ctgctcggcg tcaatgagcc gtcccggacg cgttga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page