(data stored in ACNUC7421 zone)

EMBL: CP002299.PE208

CP002299.PE208       Location/Qualifiers
FT   CDS_pept        279736..280791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78296"
FT                   /db_xref="UniProtKB/TrEMBL:E3J605"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6649"
FT                   /protein_id="ADP78296.1"
FT                   /translation="MSVDTPRPVSAATPPAEVTYDHLIIPPHWRRPEDSVAGAPNPLFP
FT                   SADGQPHPASGPHPMTGPLLVGTTARAFAKLDDIIRLSTEDKAVIDARRDEAERALRAI
FT                   FPPRCALPLVGVATIGSAGRDTMIRPLDEVDIFAVFSAANSAWKRFRWDSRDLLLCVRN
FT                   AIGGDRVQTIGTRGQALRVVYDTPPDVHLVPAFDHPRAGYVMPDRIGGWLPTRPERHAS
FT                   WTEDLGPRVISAVRLLKAWNRVCGSHLRSFHIEALAGTVLAGRGLNTRQALATVFRHMD
FT                   EAGLSMADPADVGGDLSTYLRPDDLAALGESVRMARAYAEKAVAAEGDGRHEEAVALWA
FT                   AIFGPEFPTFG"
     atgagcgtcg ataccccacg cccggtctcg gccgcgacgc cgccagctga ggtcacctac        60
     gaccacctga tcatcccgcc gcactggcgg cggcccgagg actcggtggc gggcgccccg       120
     aaccccctct tcccgtcggc ggacggccag ccgcacccgg cgtccggccc gcacccgatg       180
     acggggccgc tgctggtcgg cacgacggcc cgcgctttcg ccaagctcga cgacatcatc       240
     cggctgtcca ccgaggacaa ggccgtgatc gacgcccgcc gcgacgaggc cgagcgcgcg       300
     ctgcgggcga tcttcccgcc gcgctgcgcg ctgccgctgg tcggcgtcgc caccatcggc       360
     tccgccgggc gcgacacgat gatccgcccg ctcgacgagg tcgacatctt cgccgtgttc       420
     agtgcggcga acagcgcctg gaagcggttc cgctgggact cccgcgacct gctgctgtgc       480
     gtgcggaacg cgatcggcgg cgaccgggtc cagacgatcg gcacccgcgg ccaggcgctg       540
     cgcgtcgtgt acgacacgcc gccggacgtc cacctcgtcc cggccttcga ccacccgcgc       600
     gccggctacg tcatgcccga ccggatcggt ggctggctgc cgacccggcc cgagcggcac       660
     gccagctgga ccgaggatct cggcccccgg gtgatctcgg cggtccggct gctgaaggca       720
     tggaaccggg tgtgcggcag ccatctgcgt tcgttccaca tcgaggcgct ggccgggacc       780
     gtgctcgccg gccgcggcct gaacacccgg caggcgctgg cgaccgtgtt tcgacacatg       840
     gacgaggccg gcctctcgat ggccgacccc gccgacgtcg gcggggacct gtcgacctat       900
     ctgcggcccg acgacctggc cgcgctgggc gagtccgtcc ggatggcccg cgcctacgcg       960
     gagaaggccg tcgccgccga gggcgacggg cgccacgagg aggctgtcgc gctctgggcc      1020
     gccatcttcg gccccgagtt ccccaccttc ggctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page