(data stored in ACNUC7421 zone)

EMBL: CP002299.PE210

CP002299.PE210       Location/Qualifiers
FT   CDS_pept        complement(281759..283954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78298"
FT                   /db_xref="GOA:E3J607"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J607"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6646"
FT                   /protein_id="ADP78298.1"
FT                   /translation="MRWSRDSAQSAQQAARRHRHRVERLAEWPIGRCGRWVAVVLWLAL
FT                   ALVATPLAGRLGNAQTNDAAAFLPPNAESTQVLAAQRQLPGGDAIPAVVVFTRPTGRLT
FT                   AADQAAMKAAGAQLAPFAAAPVTPAAPAPDGRAALMIVPVAQSANADAFADEINRMRAV
FT                   VRKLAPPGLQTSVTGPAGVIVDTYTSFRGVETPLLFVTAAVVAVILLVVYRGPFLCLVP
FT                   LVAVGAADQAATAIIYLLARHGGLTVNGQSAGILRVLVFGAGTDYALLLIARYREELTR
FT                   HAAATEAMRVALLRAGPAVLASAGTVVLSLLCLLLGELNSDRGLGPVGAVGIAVAFLTM
FT                   GTLLPALLVICGRRLFWPQIPRIAAPAVTTSLKDAGNPDVVGAWARAGLLIARRPRPIW
FT                   LVTSAVLAGLTVGIVTFHIGLTDRGAFRHPIDSIIGEERIAAHFPLGASAPTFVIGASD
FT                   SAARLGDVIDATPGVATAVVDGTGAGLTQFLVVLRDPPDSAAAAATIDRLRARVRPVPG
FT                   ADALVGGTTAVNHDIAQAAMRDRQLVIPLVLVVVLVILGLLLRAAVAPLVLILTVVLSF
FT                   LASLGVSALVFRGVFHFAGADPSLPLFGFIFLVALGVDYNIFLMTRVREEAMHTDARTG
FT                   VLRGLAVTGGVITSAGVVLAATFSVLFIFPLVQLAEIGFLVAFGVLLDTLVVRSILVPA
FT                   LALDLGRVMWWPSRLSRPPTPPADLLAPDVVVSEDVP"
     atgcggtggt cgagagattc cgcacagtcg gcccagcagg cggcccggcg ccaccgccac        60
     cgggtcgagc gcctcgccga atggcccatc gggcgctgcg gtcggtgggt cgcggtcgtg       120
     ctgtggctgg cgttggcgct ggtcgccacg ccactcgcgg gccggctggg caacgcgcag       180
     accaacgacg cggcggcctt cctcccgccg aacgccgagt caacgcaggt actcgcggcc       240
     caacgtcagc ttccgggcgg cgacgcgatc cccgcggtcg tcgtcttcac ccggccgacc       300
     ggaaggctga cggccgccga ccaggcggcg atgaaggccg cgggcgccca gctggcgccc       360
     ttcgcggccg ctcccgtcac gccggcggcc ccggcgcccg acggccgggc cgcactgatg       420
     atcgtccccg tcgcccagtc ggcgaacgcg gacgccttcg ccgacgagat caaccggatg       480
     cgggccgtcg tccggaagct ggccccaccc gggttgcaga cctcggtcac cggcccggcc       540
     ggcgtcatcg tggacacgta cacgtcgttc cgcggggtcg agacgccgtt gctcttcgtc       600
     accgcggccg tcgtcgcggt gatcctgctg gtggtctacc gcgggccgtt cctgtgcctg       660
     gtgccgctgg tcgccgtggg agccgccgac caggccgcga ccgcgatcat ctacctgctg       720
     gcccggcacg ggggcctgac ggtcaacggg cagagcgcgg gcatcctgcg cgtcctggtg       780
     ttcggcgccg gcaccgacta cgccctgctg ctgatcgccc ggtaccgcga ggagctgacc       840
     cggcacgccg ccgcgaccga ggcgatgcgg gtcgcgctgc tgcgtgccgg ccccgccgtc       900
     ctggcctcgg ccggcaccgt cgtgctcagc ctgctctgcc tgctgctcgg cgagctgaac       960
     tccgaccgcg gcctcggccc ggtcggcgcg gtcgggatcg ccgtggcgtt cctgaccatg      1020
     gggactctgc tgcccgcact gctggtgatc tgcggccggc ggctgttctg gccgcagatc      1080
     ccccggatcg ccgcgccggc cgtcaccacg agcctcaagg acgccggcaa cccggacgtc      1140
     gtcggcgcct gggcccgggc gggcctgctg atcgcccgcc ggccccggcc gatctggctg      1200
     gtcaccagcg cggtgctcgc cggcctcacg gtgggcatcg tcacgttcca catcgggctc      1260
     accgaccgcg gggcgttccg gcacccgatc gactcgatca tcggcgagga gcgcatcgcg      1320
     gcgcatttcc cactgggggc cagcgcgccc acgttcgtga tcggcgccag tgacagcgcg      1380
     gccaggctcg gcgacgtcat cgacgcgacc ccgggcgtcg ccaccgcggt cgtggacggc      1440
     accggagccg ggctcaccca gttcctggtc gtcctgcgcg acccgccgga cagcgccgcg      1500
     gccgccgcga cgatcgaccg gctacgggcc agggttcgcc cggtgccggg cgcggacgcc      1560
     ctggtcggcg ggacgacggc ggtgaaccac gacatcgccc aggccgccat gcgggatcgg      1620
     cagctggtca tcccgctggt gctcgtcgtc gtgctggtga tcctgggtct gctgctgcgg      1680
     gccgcggtcg cgccgctggt gctgatcctg acggtggtgc tgtcgttcct ggcgtcgctc      1740
     ggggtgtcgg ccctggtgtt ccggggggtc ttccacttcg cgggggccga tccgtcgctg      1800
     cccctgttcg ggttcatctt cctggtggcg ctcggcgtcg actacaacat cttcctgatg      1860
     acgcgggtgc gcgaggaggc gatgcacacc gacgcccgca ccggcgtgct gcgcggtctc      1920
     gccgtcaccg gtggagtgat cacgtccgcc ggggtggtgc tggcggcgac cttctcggtg      1980
     ctgttcatct tcccgctggt gcagctcgcc gagatcggct tcctggtcgc cttcggggtg      2040
     ctgctggaca cgctggtcgt ccgctcgatc ctggtgccgg cgctggccct ggacctgggc      2100
     cgcgtcatgt ggtggccgag ccggttgagt cgcccaccga ccccgcccgc cgacctgctg      2160
     gcgccggacg tcgtcgtctc ggaggacgtc ccctag                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page