(data stored in ACNUC7421 zone)

EMBL: CP002299.PE212

CP002299.PE212       Location/Qualifiers
FT   CDS_pept        complement(285223..286182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0212"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   fal:FRAAL6645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78300"
FT                   /db_xref="GOA:E3J609"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:E3J609"
FT                   /inference="protein motif:PFAM:PF04227"
FT                   /protein_id="ADP78300.1"
FT                   /translation="MCGAYRADMPEIEVSTEVRDALAAGQPVVALESTLLAHGLPAPRN
FT                   REFAAELEQLVRDHGAIPATIAVLDGVPTVGLDDAARDRITDPAATVLKLSVRDLAPAT
FT                   ALGHTGATTVASTAWLAARAGIRVFATGGLGGVHRGGDEGSDGFSYDESADLPTLATTP
FT                   ITIVCAGVKSILDVGATLERLETLGVTVLGWQTSDFPGFYLPGTGHQLDWRVEDAGEVA
FT                   AVMAAADELGTPAAVVVAHPVAQADALDRDLHDRVLADALAAASRAGLRGKAVTPFLLA
FT                   AFHRETAGASLEVNLAVVRGNAAVAAAVSTAHAGRRHA"
     atgtgcgggg cctatcgtgc ggacatgccg gagatcgagg tgtccaccga ggttcgggac        60
     gcgctggccg ccgggcagcc ggtggtcgcg ttggagtcga cgctgctcgc gcatgggctg       120
     ccggcgccgc gcaaccggga gttcgccgcg gagctggagc agctggtacg cgatcacggc       180
     gccattcccg cgacgatcgc ggtgctcgac ggggtgccga ccgtcggtct ggacgacgcg       240
     gcccgcgaca ggattacgga tcccgcggcc accgtcctca agctgtcggt gcgcgatctc       300
     gcgccagcca ccgctctcgg ccataccggc gccaccaccg tcgcgtcgac cgcctggctc       360
     gccgccagag ccggcatccg tgtgttcgcc accggaggcc tcggcggggt ccaccgcggt       420
     ggcgacgagg gcagcgacgg tttcagctat gacgagtcgg cggacctgcc gacgctcgcc       480
     acgaccccga tcacgatcgt ctgtgccggg gtgaagtcga tccttgacgt cggcgcgacc       540
     ctggagcgac tggagactct gggcgtcacc gtgcttggct ggcagacgtc cgacttcccc       600
     ggcttctacc tgcccggtac cggccaccag ctggactggc gggtcgagga cgcgggagag       660
     gtcgccgcgg tgatggcggc cgccgacgag ctgggcacgc ccgctgccgt cgtcgtggcc       720
     catccggtgg cccaggccga cgcgctcgac cgcgacctgc acgaccgggt gctcgcggac       780
     gccctcgccg ccgccagccg ggccgggctg cgcggcaagg ccgtcacgcc gtttctgctg       840
     gccgcgttcc accgtgagac cgcgggcgcg agcctcgagg tcaacctcgc ggtcgtccgc       900
     gggaacgccg cggtcgcggc ggccgtctcg accgctcacg ccggacggcg gcacgcctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page